3PSK: Transcription elongation factor SPT6

Name: PDB 3PSK: Crystal Structure of the Spt6 Tandem SH2 Domain from Saccharomyces cerevisiae, Form Native Spt6 (1247-1451)
Published: 2011-03-30
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal Structure of the Spt6 Tandem SH2 Domain from Saccharomyces cerevisiae, Form Native Spt6 (1247-1451). Determined by X-ray diffraction at 2.1 Å resolution. Released 30 Mar 2011.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 6,784
Mol. weight: 101.41 kDa
Released: 30 Mar 2011

Explore 3PSK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PSK contains 32 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	1246	1	1
β-strand	1259	1	2
α-helix	1264-1271	8
β-strand	1279-1283	5	2
β-strand	1286	1	1
β-strand	1290-1298	9	2
β-strand	1301-1310	10	2
α-helix	1318-1319	2
β-strand	1321-1324	4	2
β-strand	1327-1329	3	2
α-helix	1332-1334	3
α-helix	1335-1340	6
α-helix	1341-1351	11
β-strand	1356	1	3
α-helix	1361-1372	12
β-strand	1380-1385	6	3
β-strand	1392-1398	7	3
β-strand	1406-1412	7	3
β-strand	1417-1419	3	3
β-strand	1422-1424	3	3
α-helix	1427-1437	11

Chain B: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	1246	1	4
β-strand	1259	1	5
α-helix	1264-1272	9
β-strand	1279-1283	5	5
β-strand	1286	1	4
β-strand	1290-1298	9	5
β-strand	1301-1310	10	5
α-helix	1318-1319	2
β-strand	1321-1324	4	5
β-strand	1327-1329	3	5
α-helix	1332-1334	3
α-helix	1335-1340	6
α-helix	1341-1351	11
β-strand	1356	1	6
α-helix	1361-1372	12
β-strand	1380-1386	7	6
β-strand	1392-1398	7	6
α-helix	1404-1405	2
β-strand	1406-1412	7	6
β-strand	1417-1419	3	6
β-strand	1422-1424	3	6
α-helix	1427-1438	12

Chain C: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	1259	1	5
α-helix	1264-1271	8
β-strand	1279-1283	5	5
β-strand	1290-1298	9	5
β-strand	1301-1310	10	5
α-helix	1318-1319	2
β-strand	1321-1324	4	5
β-strand	1327-1329	3	5
α-helix	1332-1334	3
α-helix	1335-1340	6
α-helix	1341-1351	11
β-strand	1356	1	7
α-helix	1361-1373	13
β-strand	1380-1385	6	7
β-strand	1392-1398	7	7
α-helix	1404-1405	2
β-strand	1406-1412	7	7
β-strand	1417-1419	3	7
β-strand	1422-1424	3	7
α-helix	1427-1434	8

Chain D: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	1259	1	2
α-helix	1264-1271	8
α-helix	1275	1
β-strand	1279-1283	5	2
β-strand	1290-1298	9	2
β-strand	1301-1310	10	2
α-helix	1318-1319	2
β-strand	1321-1324	4	2
β-strand	1327-1329	3	2
α-helix	1332-1334	3
α-helix	1335-1340	6
α-helix	1341-1351	11
β-strand	1356	1	8
α-helix	1361-1373	13
β-strand	1380-1385	6	8
β-strand	1392-1398	7	8
α-helix	1404-1405	2
β-strand	1406-1412	7	8
β-strand	1417-1419	3	8
β-strand	1422-1424	3	8
α-helix	1427-1437	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription elongation factor SPT6	A, B, C, D	protein	211	Saccharomyces cerevisiae	P23615 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3PSK_1 Transcription elongation factor SPT6 (chains A, B, C, D)
GIDPFTAKRTHRVINHPYYFPFNGRQAEDYLRSKERGEFVIRQSSRGDDHLVITWKLDKD
LFQHIDIQELEKENPLALGKVLIVDNQKYNDLDQIIVEYLQNKVRLLNEMTSSEKFKSGT
KKDVVKFIEDYSRVNPNKSVYYFSLNHDNPGWFYLMFKINANSKLYTWNVKLTNTGYFLV
NYNYPSVIQLCNGFKTLLKSNSSKNRMNNYR

Primary citation

Crystal structures of the S. cerevisiae Spt6 core and C-terminal tandem SH2 domain. Close, D., Johnson, S.J., Sdano, M.A. et al. J Mol Biol (2011) 408:697-713. DOI 10.1016/j.jmb.2011.03.002 · PubMed

Other PDB entries of the same protein (UniProt P23615 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VKO 1.8 Å, SPT6 tSH2-RPB1 1468-1500 pT1471, pS1493
3OAK 2.15 Å, Crystal structure of a Spn1 (Iws1)-Spt6 complex
5VKL 2.2 Å, SPT6 tSH2-RPB1 1476-1500 pS1493
3PSF 2.59 Å, Crystal Structure of the Spt6 core domain from Saccharomyces cerevisiae, Form…
3PSJ 2.7 Å, Crystal Structure of the Spt6 Tandem SH2 Domain from Saccharomyces cerevisiae, Form…
3PSI 3.3 Å, Crystal Structure of the Spt6 core domain from Saccharomyces cerevisiae, Form…
7O3D 3.71 Å, Cooperation between the intrinsically disordered and ordered regions of Spt6 regulates…
7O6B 3.88 Å, Cooperation between the intrinsically disordered and ordered regions of Spt6 regulates…
2L3T Solution structure of tandem SH2 domain from Spt6

Browse structure collections

About this viewer

MolViewer shows 3PSK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.