Human DNA polymerase kappa extending opposite a cis-syn thymine dimer. Determined by X-ray diffraction at 3.34 Å resolution. Released 28 Dec 2011.
Explore 3PZP in 3D Show helices and sheets RCSB PDB PDBe
3PZP contains 38 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 33-42 | 10 | |
| α-helix | 48-72 | 25 | |
| α-helix | 76-96 | 21 | |
| β-strand | 103-108 | 6 | 1 |
| α-helix | 111-119 | 9 | |
| α-helix | 121-123 | 3 | |
| β-strand | 128-132 | 5 | 2 |
| β-strand | 135-139 | 5 | 2 |
| α-helix | 141-144 | 4 | |
| α-helix | 154-160 | 7 | |
| β-strand | 165-167 | 3 | 2 |
| α-helix | 168-169 | 2 | |
| α-helix | 171-186 | 16 | |
| β-strand | 193 | 1 | 1 |
| β-strand | 199-203 | 5 | 1 |
| α-helix | 205-211 | 7 | |
| β-strand | 220-222 | 3 | 3 |
| β-strand | 283-285 | 3 | 3 |
| α-helix | 290-305 | 16 | |
| β-strand | 309-314 | 6 | 1 |
| α-helix | 317-325 | 9 | |
| β-strand | 332-334 | 3 | 1 |
| α-helix | 339-346 | 8 | |
| β-strand | 350 | 1 | 4 |
| α-helix | 351-353 | 3 | |
| α-helix | 359-367 | 9 | |
| β-strand | 372 | 1 | 4 |
| α-helix | 373-386 | 14 | |
| α-helix | 389-399 | 11 | |
| α-helix | 407-409 | 3 | |
| β-strand | 416-425 | 10 | 5 |
| α-helix | 428-447 | 20 | |
| β-strand | 453 | 1 | 6 |
| β-strand | 456-462 | 7 | 5 |
| β-strand | 467-470 | 4 | 5 |
| β-strand | 478 | 1 | 6 |
| α-helix | 481-499 | 19 | |
| β-strand | 506-513 | 8 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 33-44 | 12 | |
| α-helix | 48-72 | 25 | |
| α-helix | 76-94 | 19 | |
| β-strand | 103-108 | 6 | 7 |
| α-helix | 111-119 | 9 | |
| α-helix | 121-123 | 3 | |
| β-strand | 128-130 | 3 | 8 |
| β-strand | 131-132 | 2 | 9 |
| β-strand | 135-136 | 2 | 9 |
| α-helix | 141-144 | 4 | |
| α-helix | 154-160 | 7 | |
| β-strand | 165-167 | 3 | 8 |
| α-helix | 171-186 | 16 | |
| β-strand | 193-196 | 4 | 7 |
| β-strand | 199-202 | 4 | 7 |
| α-helix | 205-211 | 7 | |
| β-strand | 220-221 | 2 | 10 |
| β-strand | 284-285 | 2 | 10 |
| α-helix | 290-305 | 16 | |
| β-strand | 309-314 | 6 | 7 |
| α-helix | 317-323 | 7 | |
| β-strand | 334 | 1 | 7 |
| α-helix | 339-347 | 9 | |
| β-strand | 350 | 1 | 11 |
| α-helix | 351-353 | 3 | |
| α-helix | 359-367 | 9 | |
| β-strand | 372 | 1 | 11 |
| α-helix | 373-386 | 14 | |
| α-helix | 389-399 | 11 | |
| β-strand | 415-425 | 11 | 12 |
| α-helix | 430-447 | 18 | |
| β-strand | 453-462 | 10 | 12 |
| β-strand | 467-468 | 2 | 12 |
| β-strand | 471-478 | 8 | 12 |
| α-helix | 481-497 | 17 | |
| β-strand | 506-514 | 9 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA polymerase kappa | A, B | protein | 517 | Homo sapiens | Q9UBT6 (AlphaFold model) |
| 5'-d(*gp*gp*gp*gp*gp*ap*ap*gp*gp*ap*cp*cp*a)-3' | P, Q | DNA | 13 | ||
| 5'-d(*tp*tp*cp*cp*(ttd)p*gp*gp*tp*cp*cp*tp*tp*cp*cp*cp*cp*c)-3' | T, U | DNA | 17 |
>3PZP_1 DNA polymerase kappa (chains A, B) GPGGDPHMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQK AQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVG SMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPN FMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISPL LFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFRIEQKTTLTASA GIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGII TCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQ YSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKEL LKTEIDADFPHPLRLRLMGVRISSFPNEEDRKHQQRS
>3PZP_2 5'-D(*GP*GP*GP*GP*GP*AP*AP*GP*GP*AP*CP*CP*A)-3' (chains P, Q) GGGGGAAGGACCA
>3PZP_3 5'-D(*TP*TP*CP*CP*(TTD)P*GP*GP*TP*CP*CP*TP*TP*CP*CP*CP*CP*C)-3' (chains T, U) TTCCTGGTCCTTCCCCC
Role of human DNA polymerase kappa in extension opposite from a cis-syn thymine dimer. Vasquez-Del Carpio, R., Silverstein, T.D., Lone, S. et al. J Mol Biol (2011) 408:252-261. DOI 10.1016/j.jmb.2011.02.042 · PubMed
Other PDB entries of the same protein (UniProt Q9UBT6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3PZP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.