3Q4Z: Unphosphorylated PAK1 kinase domain

Structure of unphosphorylated PAK1 kinase domain. Determined by X-ray diffraction at 1.89 Å resolution. Released 21 Dec 2011.

Method

X-ray diffraction

Resolution

1.89 Å

Organism

Homo sapiens

Chains

2

Atoms

4,670

Mol. weight

69.56 kDa

Ligands

ANP, MG

Released

21 Dec 2011

Explore 3Q4Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3Q4Z contains 40 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 13 β-strands

Molecules and chains

>3Q4Z_1 Serine/threonine-protein kinase PAK 1 (chains A, B)
MSDEEILEKLRIIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQP
KKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIA
AVCRECLQALEFLHSNQVIHRNIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGT
PYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNP
EKLSAIFRDFLNRCLEMDVEKRGSAKELIQHQFLKIAKPLSSLTPLIAAAKEATKNNHLE
HHHHHH

Ligands and cofactors

Primary citation

Structural insights into the autoactivation mechanism of p21-activated protein kinase. Wang, J., Wu, J.-W., Wang, Z.-X. Structure (2011) 19:1752-1761. DOI 10.1016/j.str.2011.10.013 · PubMed

Related structures

Other PDB entries of the same protein (UniProt Q13153 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 3FXZ 1.64 Å, Crystal structure of PAK1 kinase domain with ruthenium complex lambda-FL172
• 2QME 1.75 Å, Crystal structure of human RAC3 in complex with CRIB domain of human p21-activated…
• 9N4U 1.77 Å, Crystal structure of PAK1 bound to compound R1
• 1YHV 1.8 Å, Crystal Structure of PAK1 kinase domain with two point mutations (K299R, T423E)
• 1YHW 1.8 Å, Crystal Structure of PAK1 kinase domain with one point mutations (K299R)
• 8X5Z 1.8 Å, The Crystal Structure of PAK1 kinase domain from Biortus.
• 3Q52 1.8 Å, Structure of phosphorylated PAK1 kinase domain
• 9D4V 1.84 Å, Structure of PAK1 in complex with compound 7
• 9D4X 1.85 Å, Structure of PAK1 in complex with compound 16
• 9D4Y 1.85 Å, Structure of PAK1 in complex with compound 31
• 9N48 1.85 Å, Crystal structure of PAK1 bound to compound C1
• 9D50 1.9 Å, Structure of PAK1 in complex with compound 24

Browse structure collections

About this viewer

MolViewer shows 3Q4Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.