3Q5M: Escherichia coli BamD

Crystal structure of Escherichia coli BamD. Determined by X-ray diffraction at 2.6 Å resolution. Released 28 Dec 2011.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Escherichia coli
Chains: 1
Atoms: 1,722
Mol. weight: 26.53 kDa
Released: 28 Dec 2011

Explore 3Q5M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3Q5M contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	10-22	13
α-helix	26-39	14
α-helix	46-59	14
α-helix	63-76	14
α-helix	83-98	16
α-helix	116-131	16
α-helix	138-165	28
α-helix	169-182	14
α-helix	187-202	16
α-helix	206-218	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
UPF0169 lipoprotein yfiO	A	protein	224	Escherichia coli	P0AC02 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3Q5M_1 UPF0169 lipoprotein yfiO (chains A)
ASKEEVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYK
NADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQHAR
AAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGM
LRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSSNT

Primary citation

Structure of Escherichia coli BamD and its functional implications in outer membrane protein assembly. Dong, C., Hou, H.F., Yang, X. et al. Acta Crystallogr D Biol Crystallogr (2012) 68:95-101. DOI 10.1107/S0907444911051031 · PubMed

Other PDB entries of the same protein (UniProt P0AC02 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2YHC 1.8 Å, Structure of BamD from E. coli
9CNW 2.6 Å, CryoEM structure of the APO-BAM complex in DDM detergent
9HG6 2.73 Å, BAM-SurA complex in the swing-in state
9HG5 2.82 Å, BAM-SurA complex in the swing-in state with full length BamC resolved
9HG7 2.83 Å, BAM-SurA complex in the swing-out state
9HG9 2.88 Å, BAM-SurA-darobactin complex in the swing-in state
3TGO 2.9 Å, Crystal structure of the E. coli BamCD complex
5D0O 2.9 Å, BamABCDE complex, outer membrane beta barrel assembly machinery entire complex
8PZV 2.9 Å, Wait Complex: BAM bound Darobactin-B and Extended SurA
9HG8 2.9 Å, BAM-SurA complex in the swing-out state with BamC resolved
8ADG 3.0 Å, Cryo-EM structure of Darobactin 22 bound BAM complex
9HE1 3.0 Å, Structure of the Xenorceptide A2-bound E. coli BAM complex (BamABCDE)

Browse structure collections

About this viewer

MolViewer shows 3Q5M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.