3Q90: Ras GTPase-activating protein-binding protein 1

Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1. Determined by X-ray diffraction at 1.7 Å resolution. Released 16 Feb 2011.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,168
Mol. weight: 31.97 kDa
Released: 16 Feb 2011

Explore 3Q90 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3Q90 contains 11 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-25	18
α-helix	27-33	7
β-strand	34-40	7	1
β-strand	55-56	2	1
α-helix	57-67	11
β-strand	74-84	11	1
α-helix	86-88	3
β-strand	90-99	10	1
β-strand	106-116	11	1
β-strand	124-133	10	1
α-helix	134-136	3

Chain B: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
α-helix	8-25	18
α-helix	27-33	7
β-strand	34-42	9	2
α-helix	52-54	3
β-strand	55-56	2	2
α-helix	58-67	10
β-strand	74-84	11	2
β-strand	90-99	10	2
β-strand	106-115	10	2
β-strand	125-133	9	2
α-helix	134-136	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras GTPase-activating protein-binding protein 1	A, B	protein	140	Homo sapiens	Q13283 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3Q90_1 Ras GTPase-activating protein-binding protein 1 (chains A, B)
SMVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQK
EIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGS
VANKFYVHNDIFRYQDEVFG

Primary citation

Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1. Welin, M., Tresaugues, L., Arrowsmith, C.H. et al. To be published.

Other PDB entries of the same protein (UniProt Q13283 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FCJ 1.62 Å, Crystal structure of the NTF2-like domain of human G3BP1
8TH1 1.8 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
5FW5 1.92 Å, Crystal structure of human G3BP1 in complex with Semliki Forest Virus nsP3-25 comprising…
6TA7 1.93 Å, Crystal structure of human G3BP1-NTF2 in complex with human CAPRIN1-derived solomon motif
8TH6 2.34 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to USP10 peptide
7SUO 2.35 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
7S17 2.36 Å, Crystal structure of human G3BP1-NTF2 with three mutations- F15W, F33W, and F124W
9CC6 2.4 Å, De novo design of high-affinity protein binders to RNA binding domain of G3bp1
7XHG 2.46 Å, Crystal structure of the NTF2L domain of human G3BP1 in complex with the Caprin-1…
8TH5 2.62 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
9IVQ 2.66 Å, Cryo-EM structure of the CHIKV nsP3 peptide in complex with the NTF2L domain of G3BP1…
7XHF 2.68 Å, Crystal structure of the NTF2L domain of human G3BP1 in complex with the USP10 derived…

Browse structure collections

About this viewer

MolViewer shows 3Q90 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.