5FW5: Human G3BP1

Crystal structure of human G3BP1 in complex with Semliki Forest Virus nsP3-25 comprising two FGDF motives. Determined by X-ray diffraction at 1.92 Å resolution. Released 20 Jul 2016.

Method: X-ray diffraction
Resolution: 1.92 Å
Organisms: HOMO SAPIENS, SEMLIKI FOREST VIRUS
Chains: 3
Atoms: 2,731
Mol. weight: 35.66 kDa
Released: 20 Jul 2016

Explore 5FW5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FW5 contains 15 α-helices and 15 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	8-25	18
α-helix	27-33	7
β-strand	34-42	9	1
β-strand	45	1	2
β-strand	51	1	2
α-helix	52-54	3
β-strand	55-56	2	1
α-helix	57-67	11
β-strand	74-84	11	1
α-helix	86-88	3
β-strand	90-99	10	1
β-strand	106-116	11	1
β-strand	123-133	11	1
α-helix	134-136	3

Chain B: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-25	18
α-helix	27-33	7
β-strand	34-42	9	3
α-helix	50-52	3
β-strand	55-56	2	3
α-helix	58-67	10
β-strand	74-84	11	3
α-helix	86-88	3
β-strand	90-99	10	3
α-helix	103-105	3
β-strand	106-116	11	3
β-strand	124-133	10	3

Chain C: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	450-451	2	1
α-helix	454-455	2
α-helix	458-463	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras gtpase-activating protein-binding protein 1	A, B	protein	140	HOMO SAPIENS	Q13283 (AlphaFold model)
Non-structural protein 3	C	protein	25	SEMLIKI FOREST VIRUS	P08411 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5FW5_1 RAS GTPASE-ACTIVATING PROTEIN-BINDING PROTEIN 1 (chains A, B)
SMVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQK
EIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGS
VANKFYVHNDIFRYQDEVFG

Sequence of entity 2 (C), FASTA

>5FW5_2 NON-STRUCTURAL PROTEIN 3 (chains C)
LTFGDFDEHEVDALASGITFGDFDD

Primary citation

Combined structural, biochemical and cellular evidence demonstrates that both FGDF motifs in alphavirus nsP3 are required for efficient replication. Schulte, T., Liu, L., Panas, M.D. et al. Open Biol (2016) 6. DOI 10.1098/rsob.160078 · PubMed

Other PDB entries of the same protein (UniProt Q13283 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FCJ 1.62 Å, Crystal structure of the NTF2-like domain of human G3BP1
3Q90 1.7 Å, Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1
8TH1 1.8 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
6TA7 1.93 Å, Crystal structure of human G3BP1-NTF2 in complex with human CAPRIN1-derived solomon motif
8TH6 2.34 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to USP10 peptide
7SUO 2.35 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
7S17 2.36 Å, Crystal structure of human G3BP1-NTF2 with three mutations- F15W, F33W, and F124W
9CC6 2.4 Å, De novo design of high-affinity protein binders to RNA binding domain of G3bp1
7XHG 2.46 Å, Crystal structure of the NTF2L domain of human G3BP1 in complex with the Caprin-1…
8TH5 2.62 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
9IVQ 2.66 Å, Cryo-EM structure of the CHIKV nsP3 peptide in complex with the NTF2L domain of G3BP1…
7XHF 2.68 Å, Crystal structure of the NTF2L domain of human G3BP1 in complex with the USP10 derived…

Browse structure collections

About this viewer

MolViewer shows 5FW5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.