6TA7: Human G3BP1-NTF2

Crystal structure of human G3BP1-NTF2 in complex with human CAPRIN1-derived solomon motif. Determined by X-ray diffraction at 1.93 Å resolution. Released 12 May 2021.

Method: X-ray diffraction
Resolution: 1.93 Å
Organism: Homo sapiens
Chains: 8
Atoms: 6,516
Mol. weight: 103.47 kDa
Released: 12 May 2021

Explore 6TA7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TA7 contains 35 α-helices and 47 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	1-2	2	1
α-helix	4-7	4
α-helix	8-25	18
α-helix	27-33	7
β-strand	34-42	9	2
β-strand	45	1	3
β-strand	51	1	3
α-helix	52-54	3
β-strand	55-56	2	2
α-helix	58-67	10
β-strand	74-84	11	2
α-helix	86-88	3
β-strand	90-99	10	2
β-strand	106-114	9	2
β-strand	126-133	8	2

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	8-25	18
α-helix	27-33	7
β-strand	34-42	9	1
β-strand	45	1	4
α-helix	50	1
β-strand	51	1	4
α-helix	52-54	3
β-strand	55-56	2	1
α-helix	58-67	10
β-strand	74-84	11	1
α-helix	86-88	3
β-strand	90-99	10	1
β-strand	106-115	10	1
β-strand	125-133	9	1
α-helix	134-137	4

Chain C: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	8-25	18
α-helix	27-33	7
β-strand	34-42	9	9
β-strand	45	1	10
β-strand	51	1	10
α-helix	52-54	3
β-strand	55-56	2	9
α-helix	58-68	11
β-strand	74-84	11	9
α-helix	86-88	3
β-strand	90-99	10	9
β-strand	106-115	10	9
β-strand	125-133	9	9
α-helix	134-137	4

Chain D: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	8-25	18
α-helix	27-33	7
β-strand	34-41	8	5
β-strand	55-56	2	5
α-helix	57-67	11
β-strand	74-84	11	5
α-helix	86-88	3
β-strand	90-99	10	5
β-strand	106-116	11	5
β-strand	123	1	6
β-strand	124-133	10	5

Chain E: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-25	18
α-helix	27-33	7
β-strand	34-41	8	11
β-strand	55-56	2	11
α-helix	58-67	10
β-strand	74-84	11	11
α-helix	86-88	3
β-strand	90-99	10	11
β-strand	106-116	11	11
β-strand	124-133	10	11

Chain F: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
α-helix	8-25	18
α-helix	27-33	7
β-strand	34-41	8	7
β-strand	55-56	2	7
α-helix	57-67	11
β-strand	74-84	11	7
α-helix	86-88	3
β-strand	90-99	10	7
β-strand	106-116	11	7
β-strand	123	1	8
β-strand	124-133	10	7

Chain G: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	364-366	3
β-strand	371	1	6

Chain H: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	371	1	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras GTPase-activating protein-binding protein 1	A, B, C, D, E, F	protein	140	Homo sapiens	Q13283 (AlphaFold model)
Caprin-1	G, H	protein	31	Homo sapiens	Q14444 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>6TA7_1 Ras GTPase-activating protein-binding protein 1 (chains A, B, C, D, E, F)
SMVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQK
EIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGS
VANKFYVHNDIFRYQDEVFG

Sequence of entity 2 (G, H), FASTA

>6TA7_2 Caprin-1 (chains G, H)
RQRVQDLMAQMQGPYNFIQDSMLDFENQTLD

Primary citation

Caprin-1 binding to the critical stress granule protein G3BP1 is regulated by pH. Schulte, T., Panas, M.D., Williams, L. et al. bioRxiv (2021). DOI 10.1101/2021.02.05.429362

Other PDB entries of the same protein (UniProt Q13283 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FCJ 1.62 Å, Crystal structure of the NTF2-like domain of human G3BP1
3Q90 1.7 Å, Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1
8TH1 1.8 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
5FW5 1.92 Å, Crystal structure of human G3BP1 in complex with Semliki Forest Virus nsP3-25 comprising…
8TH6 2.34 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to USP10 peptide
7SUO 2.35 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
7S17 2.36 Å, Crystal structure of human G3BP1-NTF2 with three mutations- F15W, F33W, and F124W
9CC6 2.4 Å, De novo design of high-affinity protein binders to RNA binding domain of G3bp1
7XHG 2.46 Å, Crystal structure of the NTF2L domain of human G3BP1 in complex with the Caprin-1…
8TH5 2.62 Å, Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2…
9IVQ 2.66 Å, Cryo-EM structure of the CHIKV nsP3 peptide in complex with the NTF2L domain of G3BP1…
7XHF 2.68 Å, Crystal structure of the NTF2L domain of human G3BP1 in complex with the USP10 derived…

Browse structure collections

About this viewer

MolViewer shows 6TA7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.