3QC8: FAF1 UBX Domain

Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The Conserved FcisP Touch-Turn Motif of UBX Domain Suffering Conformational Change. Determined by X-ray diffraction at 2.2 Å resolution. Released 20 Jul 2011.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,148
Mol. weight: 30.12 kDa
Released: 20 Jul 2011

Explore 3QC8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QC8 contains 12 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	24-29	6	1
β-strand	38-42	5	1
α-helix	43-49	7
β-strand	56-60	5	1
β-strand	66-74	9	1
β-strand	81-84	4	1
α-helix	86-91	6
β-strand	99-104	6	1
α-helix	108-109	2
β-strand	110	1	2
α-helix	111	1
β-strand	113-118	6	3
β-strand	119	1	4
α-helix	120-123	4
α-helix	130	1
α-helix	131-135	5
α-helix	136-139	4
β-strand	144-147	4	2
β-strand	151-155	5	3
β-strand	160-169	10	3
β-strand	173-176	4	2
β-strand	181-183	3	3
α-helix	187-188	2
β-strand	189	1	4
α-helix	190	1

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	573-579	7	5
β-strand	585-591	7	5
β-strand	595	1	6
α-helix	597-605	9
β-strand	613-617	5	5
β-strand	622-623	2	5
α-helix	624-626	3
β-strand	632	1	6
β-strand	641-648	8	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transitional endoplasmic reticulum ATPase	A	protein	178	Homo sapiens	P55072 (AlphaFold model)
FAS-associated factor 1	B	protein	84	Homo sapiens	Q9UNN5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3QC8_1 Transitional endoplasmic reticulum ATPase (chains A)
GSNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCS
DEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPY
FLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEE

Sequence of entity 2 (B), FASTA

>3QC8_2 FAS-associated factor 1 (chains B)
GSEFEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQ
LDPNKSLLEVKLFPQETLFLEAKE

Primary citation

Crystal structure of FAF1 UBX domain in complex with p97/VCP N domain reveals a conformational change in the conserved FcisP touch-turn motif of UBX domain. Kim, K.H., Kang, W., Suh, S.W. et al. Proteins (2011) 79:2583-2587. DOI 10.1002/prot.23073 · PubMed

Other PDB entries of the same protein (UniProt P55072 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5B6C 1.55 Å, Structural Details of Ufd1 binding to p97
7PUX 1.73 Å, Structure of p97 N-D1(L198W) in complex with Fragment TROLL2
3TIW 1.8 Å, Crystal structure of p97N in complex with the C-terminus of gp78
4KDL 1.81 Å, Crystal structure of p97/VCP N in complex with OTU1 UBXL
4KDI 1.86 Å, Crystal structure of p97/VCP N in complex with OTU1 UBXL
5EPP 1.88 Å, Structural Insights into the Interaction of p97 N-terminus Domain and VBM Motif in…
3EBB 1.9 Å, PLAP/P97 complex
6G2V 1.9 Å, Crystal structure of the p97 D2 domain in a helical split-washer conformation
6G2Z 1.92 Å, Crystal structure of the p97 D2 domain in a helical split-washer conformation
4KO8 1.98 Å, Structure of p97 N-D1 R155H mutant in complex with ATPgS
3QQ8 2.0 Å, Crystal structure of p97-N in complex with FAF1-UBX
3QWZ 2.0 Å, Crystal structure of FAF1 UBX-p97N-domain complex

Browse structure collections

About this viewer

MolViewer shows 3QC8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.