3QDO: PDB entry 3QDO

Crystal Structure of PDZ domain of sorting nexin 27 (SNX27) fused to the Gly-Gly linker followed by C-terminal (ESESKV) of GIRK3. Determined by X-ray diffraction at 1.88 Å resolution. Released 16 Mar 2011.

Method: X-ray diffraction
Resolution: 1.88 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 906
Mol. weight: 11.34 kDa
Released: 16 Mar 2011

Explore 3QDO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QDO contains 4 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	39-45	7	2
α-helix	46	1
β-strand	47	1	3
β-strand	50	1	3
β-strand	53-56	4	2
β-strand	66-68	3	4
β-strand	71-73	3	4
β-strand	78-82	5	2
α-helix	87-91	5
β-strand	98-102	5	2
β-strand	105-106	2	2
α-helix	112-119	8
β-strand	125-131	7	2
α-helix	132	1
β-strand	201	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-27, G protein-activated inward rectifier potassium channel 3 chimera	A	protein	109	Rattus norvegicus	Q8K4V4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3QDO_1 Sorting nexin-27, G protein-activated inward rectifier potassium channel 3 chimera (chains A)
GSHGGSPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAG
VRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSVGGESESKV

Primary citation

Mechanism underlying selective regulation of G protein-gated inwardly rectifying potassium channels by the psychostimulant-sensitive sorting nexin 27. Balana, B., Maslennikov, I., Kwiatkowski, W. et al. Proc Natl Acad Sci U S A (2011) 108:5831-5836. DOI 10.1073/pnas.1018645108 · PubMed

Other PDB entries of the same protein (UniProt Q8K4V4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EMB 0.85 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal phosphorylated PTHR…
4Z8J 0.95 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal PTHR PDZ binding motif
5ELQ 1.1 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal DGKzeta PDZ binding…
5EMA 1.32 Å, Crystal structure of the SNX27 PDZ domain bound to the phosphorylated C-terminal LRRC3B…
5EM9 1.6 Å, Crystal structure of the SNX27 PDZ domain bound to the phosphorylated C-terminal…
3QE1 1.68 Å, Crystal Structure of PDZ domain of sorting nexin 27 (SNX27) fused to the C-terminal…
4P2A 2.7 Å, Structure of mouse VPS26A bound to rat SNX27 PDZ domain
3QGL 3.31 Å, Crystal Structure of PDZ domain of sorting nexin 27 (SNX27) in complex with the ESESKV…

Browse structure collections

About this viewer

MolViewer shows 3QDO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.