Crystal structure of the SNX27 PDZ domain bound to the C-terminal DGKzeta PDZ binding motif. Determined by X-ray diffraction at 1.1 Å resolution. Released 7 Sept 2016.
Explore 5ELQ in 3D Show helices and sheets RCSB PDB PDBe
5ELQ contains 4 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 42-47 | 6 | 1 |
| β-strand | 49 | 1 | 2 |
| β-strand | 52 | 1 | 2 |
| β-strand | 55-60 | 6 | 1 |
| β-strand | 68-70 | 3 | 3 |
| β-strand | 73-75 | 3 | 3 |
| β-strand | 80-84 | 5 | 1 |
| α-helix | 89-93 | 5 | |
| β-strand | 100-104 | 5 | 1 |
| β-strand | 107-108 | 2 | 1 |
| α-helix | 114-121 | 8 | |
| β-strand | 127-133 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 41-47 | 7 | 4 |
| β-strand | 49 | 1 | 5 |
| β-strand | 52 | 1 | 5 |
| β-strand | 55-60 | 6 | 4 |
| β-strand | 68-70 | 3 | 6 |
| β-strand | 73-75 | 3 | 6 |
| β-strand | 80-84 | 5 | 4 |
| α-helix | 89-93 | 5 | |
| β-strand | 100-104 | 5 | 4 |
| β-strand | 107-108 | 2 | 4 |
| α-helix | 114-121 | 8 | |
| β-strand | 127-133 | 7 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 202-206 | 5 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sorting nexin-27 | A, B | protein | 101 | Rattus norvegicus | Q8K4V4 (AlphaFold model) |
| Glu-asp-gln-glu-thr-ala-val | C, P | protein | 8 | Homo sapiens | Q13574 (AlphaFold model) |
>5ELQ_1 Sorting nexin-27 (chains A, B) GSHGGSPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAG VRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSV
>5ELQ_2 GLU-ASP-GLN-GLU-THR-ALA-VAL (chains C, P) REDQETAV
A molecular code for endosomal recycling of phosphorylated cargos by the SNX27-retromer complex. Clairfeuille, T., Mas, C., Chan, A.S. et al. Nat Struct Mol Biol (2016) 23:921-932. DOI 10.1038/nsmb.3290 · PubMed
Other PDB entries of the same protein (UniProt Q8K4V4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5ELQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.