5EM9: SNX27 PDZ domain

Crystal structure of the SNX27 PDZ domain bound to the phosphorylated C-terminal 5HT4(a)R PDZ binding motif. Determined by X-ray diffraction at 1.6 Å resolution. Released 7 Sept 2016.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 2
Atoms: 891
Mol. weight: 11.56 kDa
Released: 7 Sept 2016

Explore 5EM9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EM9 contains 2 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	40-45	6	1
β-strand	47	1	2
β-strand	50	1	2
β-strand	53-57	5	1
β-strand	66-68	3	3
β-strand	71-73	3	3
β-strand	78-82	5	1
α-helix	87-91	5
β-strand	98-102	5	1
β-strand	105-106	2	1
α-helix	112-119	8
β-strand	125-131	7	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	383-386	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-27	A	protein	101	Rattus norvegicus	Q8K4V4 (AlphaFold model)
Sep-leu-glu-ser-cys-phe	B	protein	8	Homo sapiens

Sequence of entity 1 (A), FASTA

>5EM9_1 Sorting nexin-27 (chains A)
GSHGGSPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAG
VRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSV

Sequence of entity 2 (B), FASTA

>5EM9_2 SEP-LEU-GLU-SER-CYS-PHE (chains B)
PESLESCF

Primary citation

A molecular code for endosomal recycling of phosphorylated cargos by the SNX27-retromer complex. Clairfeuille, T., Mas, C., Chan, A.S. et al. Nat Struct Mol Biol (2016) 23:921-932. DOI 10.1038/nsmb.3290 · PubMed

Other PDB entries of the same protein (UniProt Q8K4V4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EMB 0.85 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal phosphorylated PTHR…
4Z8J 0.95 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal PTHR PDZ binding motif
5ELQ 1.1 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal DGKzeta PDZ binding…
5EMA 1.32 Å, Crystal structure of the SNX27 PDZ domain bound to the phosphorylated C-terminal LRRC3B…
3QE1 1.68 Å, Crystal Structure of PDZ domain of sorting nexin 27 (SNX27) fused to the C-terminal…
3QDO 1.88 Å, Crystal Structure of PDZ domain of sorting nexin 27 (SNX27) fused to the Gly-Gly linker…
4P2A 2.7 Å, Structure of mouse VPS26A bound to rat SNX27 PDZ domain
3QGL 3.31 Å, Crystal Structure of PDZ domain of sorting nexin 27 (SNX27) in complex with the ESESKV…

Browse structure collections

About this viewer

MolViewer shows 5EM9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.