3QI2: PDB entry 3QI2

A Galpha P-loop mutation prevents transition to the activated state: G42R bound to RGS14 GoLoco. Determined by X-ray diffraction at 2.8 Å resolution. Released 1 Feb 2012.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,714
Mol. weight: 84.42 kDa
Ligands: GDP
Released: 1 Feb 2012

Explore 3QI2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QI2 contains 45 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	32-39	8	1
α-helix	46-56	11
α-helix	63-68	6
α-helix	70-90	21
α-helix	93-95	3
α-helix	100-113	14
α-helix	121-132	12
α-helix	134-141	8
α-helix	143-145	3
α-helix	152-157	6
α-helix	159-163	5
α-helix	171-176	6
β-strand	184-191	8	1
β-strand	194-201	8	1
α-helix	208-215	8
β-strand	220-226	7	1
α-helix	227-230	4
α-helix	232-235	4
α-helix	242-255	14
α-helix	257-259	3
β-strand	263-269	7	1
α-helix	271-277	7
α-helix	283-285	3
α-helix	296-308	13
β-strand	320-323	4	1
α-helix	329-345	17

Chain B: 20 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	36-40	5	2
α-helix	46-56	11
α-helix	63-68	6
α-helix	70-90	21
α-helix	100-111	12
α-helix	121-131	11
α-helix	134-141	8
α-helix	143-145	3
α-helix	152-157	6
α-helix	159-162	4
α-helix	171-176	6
β-strand	186-190	5	2
β-strand	195-200	6	2
α-helix	205-207	3
α-helix	212-215	4
β-strand	220-226	7	2
α-helix	227-231	5
α-helix	232-234	3
α-helix	242-254	13
α-helix	257-259	3
β-strand	263-269	7	2
α-helix	271-277	7
α-helix	283-285	3
α-helix	296-308	13
β-strand	319-323	5	2
α-helix	329-344	16

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	497-507	11
α-helix	525-527	3

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	501-507	7
α-helix	521-523	3
α-helix	528-530	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide-binding protein G(i) subunit alpha-1	A, B	protein	328	Homo sapiens	P63096 (AlphaFold model)
Regulator of G-protein signaling 14	C, D	protein	36		O43566 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3QI2_1 Guanine nucleotide-binding protein G(i) subunit alpha-1 (chains A, B)
SNAGAREVKLLLLGARESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIR
AMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREY
QLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRS
ERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIIL
FLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCA
TDTKNVQFVFDAVTDVIIKNNLKDCGLF

Sequence of entity 2 (C, D), FASTA

>3QI2_2 Regulator of G-protein signaling 14 (chains C, D)
DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	2

Water and common crystallization additives (SO4, GOL) are not listed.

Primary citation

A P-loop Mutation in Galpha Subunits Prevents Transition to the Active State: Implications for G-protein Signaling in Fungal Pathogenesis. Bosch, D.E., Willard, F.S., Ramanujam, R. et al. PLoS Pathog (2012) 8:e1002553-e1002553. DOI 10.1371/journal.ppat.1002553 · PubMed

Other PDB entries of the same protein (UniProt P63096 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6CRK 2.0 Å, Heterotrimeric G-protein in complex with an antibody fragment
3UMR 2.04 Å, Crystal structure of the G202D mutant of human G-alpha-i1
9P7Z 2.1 Å, NTSR1-Gi-NTS(8-13) Complex in the Canonical, AHD Open State (C-Open-Apo)
2OM2 2.2 Å, Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14
8YN9 2.3 Å, Cryo-EM structure of histamine H4 receptor in complex with histamine and Gi
9HYI 2.3 Å, DP81-bound serotonin 5-HT1A receptor - Gi Protein Complex
9O36 2.3 Å, CryoEM structure of mu-opioid receptor - Gi protein complex bound to fluornitrazene (FNZ)
9P80 2.3 Å, NTSR1-Gi-NTS(8-13) Complex in the Non-Canonical, AHD Open State (NC-Open-Apo)
8XXV 2.33 Å, Cryo-EM Structure of the Prostaglandin D2 Receptor 2-indomethacin Coupled to G Protein
3UMS 2.34 Å, Crystal structure of the G202A mutant of human G-alpha-i1
3ONW 2.38 Å, Structure of a G-alpha-i1 mutant with enhanced affinity for the RGS14 GoLoco motif.
20ZG 2.4 Å, Cryo-EM structure of the human neurotensin receptor 1 (hNTSR1)-Gi1 complex in the…

Browse structure collections

About this viewer

MolViewer shows 3QI2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.