3QIK: First PDZ domain of PREX1

Crystal structure of the first PDZ domain of PREX1. Determined by X-ray diffraction at 2.29 Å resolution. Released 16 Feb 2011.

Method: X-ray diffraction
Resolution: 2.29 Å
Organism: Homo sapiens
Chains: 1
Atoms: 814
Mol. weight: 11.52 kDa
Released: 16 Feb 2011

Explore 3QIK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QIK contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	607-617	11
α-helix	618-622	5
β-strand	623-628	6	1
β-strand	637-642	6	2
β-strand	645-651	7	2
α-helix	656-660	5
β-strand	667	1	2
β-strand	668-671	4	1
β-strand	674-675	2	1
α-helix	681-693	13
α-helix	696-697	2
β-strand	698-703	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein	A	protein	101	Homo sapiens	Q8TCU6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3QIK_1 Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein (chains A)
GKNKQLRNDFKLVENILAKRLLILPQEEDYGFDIEEKNKAVVVKSVQRGSLAEVAGLQVG
RKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRLLVATKA

Primary citation

Crystal structure of the first PDZ domain of PREX1. Shen, L., Tong, Y., Tempel, W. et al. To be published.

Other PDB entries of the same protein (UniProt Q8TCU6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D3X 1.69 Å, Crystal Structure of the P-Rex1 PH domain with Inositol-(1,3,4,5)-Tetrakisphosphate Bound
5D3V 1.85 Å, Crystal Structure of the P-Rex1 PH domain with Citrate Bound
5D3W 1.85 Å, Crystal Structure of the P-Rex1 PH domain with Sulfate Bound
5D27 1.92 Å, Crystal Structure of the P-Rex1 PH domain
4YON 1.95 Å, P-Rex1:Rac1 complex
5D3Y 1.95 Å, Crystal Structure of the P-Rex1 PH domain with Inositol-(1,3,4,5)-Tetrakisphosphate Bound
6VSK 3.12 Å, Crystal structure of the P-Rex1 DEP1 domain
6PCV 3.2 Å, Single Particle Reconstruction of Phosphatidylinositol (3,4,5) trisphosphate-dependent…
5FI1 3.2 Å, Crystal Structure of the P-Rex1 DH/PH tandem in complex with Cdc42
7RX9 3.22 Å, Structure of autoinhibited P-Rex1
5FI0 3.28 Å, Crystal Structure of the P-Rex1 DH/PH tandem in complex with Rac1
8TUA 4.1 Å, Full-length P-Rex1 in complex with inositol 1,3,4,5-tetrakisphosphate (IP4)

Browse structure collections

About this viewer

MolViewer shows 3QIK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.