5FI1: P-Rex1 DH/PH tandem

Crystal Structure of the P-Rex1 DH/PH tandem in complex with Cdc42. Determined by X-ray diffraction at 3.2 Å resolution. Released 20 Apr 2016.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,194
Mol. weight: 64.68 kDa
Released: 20 Apr 2016

Explore 5FI1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FI1 contains 27 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	-1-70	35
α-helix	71-76	6
α-helix	77-81	5
α-helix	83-88	6
α-helix	93-100	8
α-helix	103-120	18
α-helix	132-137	6
α-helix	139-144	6
α-helix	145-164	20
α-helix	166-178	13
α-helix	188-198	11
α-helix	202-212	11
α-helix	220-255	36
β-strand	257-258	2	1
α-helix	265-268	4
β-strand	272-282	11	1
β-strand	285-294	10	1
β-strand	297-303	7	1
β-strand	325-332	8	1
α-helix	333-335	3
β-strand	336-341	6	1
α-helix	353-355	3
β-strand	358-363	6	1
β-strand	368-373	6	1
α-helix	377-395	19

Chain B: 10 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-10	8	2
α-helix	16-24	9
β-strand	40-46	7	2
β-strand	49-57	9	2
α-helix	68-70	3
β-strand	77-83	7	2
α-helix	87-92	6
α-helix	93-97	5
α-helix	98-104	7
β-strand	110-115	6	2
α-helix	117-119	3
α-helix	123-131	9
α-helix	136-138	3
α-helix	139-148	10
β-strand	154-156	3	2
β-strand	158	1	3
β-strand	163	1	3
α-helix	165-176	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein,Phosphatidylinositol…	A	protein	374	Homo sapiens	Q8TCU6 (AlphaFold model)
Cell division control protein 42 homolog	B	protein	194	Homo sapiens	P60953 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5FI1_1 Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein,Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein (chains A)
GEFAAARESERQLRLRLCVLNEILGTERDYVGTLRFLQSAFLHRIRQNVADSVEKGLTEE
NVKVLFSNIEDILEVHKDFLAALEYCLHPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEK
ALRLLVELNKIPTVRAFLLSCMLLGGRKTTDIPLEGYLLSPIQRICKYPLLLKELAKRTP
GKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLL
QGTLLKISAGNIQERAFFLFDNLLVYCKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTE
VMEVENVEDGTADYHSNGYTVTNGWKIHNTAKNKWFVCMAKTAEEKQKWLDAIIREREQR
ESLKLGMERDAYVM

Sequence of entity 2 (B), FASTA

>5FI1_2 Cell division control protein 42 homolog (chains B)
GEFMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFD
TAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQI
DLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAAL
EPPEPKKSRRCVLL

Primary citation

Structural and Biochemical Characterization of the Catalytic Core of the Metastatic Factor P-Rex1 and Its Regulation by PtdIns(3,4,5)P3. Cash, J.N., Davis, E.M., Tesmer, J.J. Structure (2016) 24:730-740. DOI 10.1016/j.str.2016.02.022 · PubMed

Other PDB entries of the same protein (UniProt Q8TCU6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D3X 1.69 Å, Crystal Structure of the P-Rex1 PH domain with Inositol-(1,3,4,5)-Tetrakisphosphate Bound
5D3V 1.85 Å, Crystal Structure of the P-Rex1 PH domain with Citrate Bound
5D3W 1.85 Å, Crystal Structure of the P-Rex1 PH domain with Sulfate Bound
5D27 1.92 Å, Crystal Structure of the P-Rex1 PH domain
4YON 1.95 Å, P-Rex1:Rac1 complex
5D3Y 1.95 Å, Crystal Structure of the P-Rex1 PH domain with Inositol-(1,3,4,5)-Tetrakisphosphate Bound
3QIK 2.29 Å, Crystal structure of the first PDZ domain of PREX1
6VSK 3.12 Å, Crystal structure of the P-Rex1 DEP1 domain
6PCV 3.2 Å, Single Particle Reconstruction of Phosphatidylinositol (3,4,5) trisphosphate-dependent…
7RX9 3.22 Å, Structure of autoinhibited P-Rex1
5FI0 3.28 Å, Crystal Structure of the P-Rex1 DH/PH tandem in complex with Rac1
8TUA 4.1 Å, Full-length P-Rex1 in complex with inositol 1,3,4,5-tetrakisphosphate (IP4)

Browse structure collections

About this viewer

MolViewer shows 5FI1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.