3QQ8: P97-N

Crystal structure of p97-N in complex with FAF1-UBX. Determined by X-ray diffraction at 2.0 Å resolution. Released 22 Jun 2011.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,262
Mol. weight: 30.89 kDa
Released: 22 Jun 2011

Explore 3QQ8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QQ8 contains 9 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	25-30	6	1
β-strand	38-41	4	1
α-helix	43-48	6
β-strand	56-60	5	1
α-helix	62-64	3
β-strand	66-73	8	1
β-strand	81-84	4	1
α-helix	86-92	7
β-strand	99-104	6	1
β-strand	110	1	2
β-strand	113-118	6	3
α-helix	123-126	4
α-helix	130	1
α-helix	131-135	5
α-helix	136-139	4
β-strand	145-147	3	2
β-strand	151-156	6	3
β-strand	159-169	11	3
β-strand	173-175	3	2
β-strand	181-184	4	3

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	573-579	7	4
β-strand	585-591	7	4
β-strand	595	1	5
α-helix	596-605	10
β-strand	613-617	5	4
β-strand	622-623	2	4
α-helix	624-626	3
β-strand	632	1	5
β-strand	641-648	8	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transitional endoplasmic reticulum ATPase	A	protein	186	Homo sapiens	P55072 (AlphaFold model)
FAS-associated factor 1	B	protein	85	Homo sapiens	Q9UNN5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3QQ8_1 Transitional endoplasmic reticulum ATPase (chains A)
ASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKG
KKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDD
TVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTV
IHCEGE

Sequence of entity 2 (B), FASTA

>3QQ8_2 FAS-associated factor 1 (chains B)
MSENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVT
QLDPNKSLLEVKLFPQETLFLEAKE

Primary citation

Hierarchical Binding of Cofactors to the AAA ATPase p97. Hanzelmann, P., Buchberger, A., Schindelin, H. Structure (2011) 19:833-843. DOI 10.1016/j.str.2011.03.018 · PubMed

Other PDB entries of the same protein (UniProt P55072 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5B6C 1.55 Å, Structural Details of Ufd1 binding to p97
7PUX 1.73 Å, Structure of p97 N-D1(L198W) in complex with Fragment TROLL2
3TIW 1.8 Å, Crystal structure of p97N in complex with the C-terminus of gp78
4KDL 1.81 Å, Crystal structure of p97/VCP N in complex with OTU1 UBXL
4KDI 1.86 Å, Crystal structure of p97/VCP N in complex with OTU1 UBXL
5EPP 1.88 Å, Structural Insights into the Interaction of p97 N-terminus Domain and VBM Motif in…
3EBB 1.9 Å, PLAP/P97 complex
6G2V 1.9 Å, Crystal structure of the p97 D2 domain in a helical split-washer conformation
6G2Z 1.92 Å, Crystal structure of the p97 D2 domain in a helical split-washer conformation
4KO8 1.98 Å, Structure of p97 N-D1 R155H mutant in complex with ATPgS
3QWZ 2.0 Å, Crystal structure of FAF1 UBX-p97N-domain complex
6G2X 2.08 Å, Crystal structure of the p97 D2 domain in a helical split-washer conformation

Browse structure collections

About this viewer

MolViewer shows 3QQ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.