3QWL: Human TBC1 domain family member 7

Crystal structure of human TBC1 domain family member 7. Determined by X-ray diffraction at 1.9 Å resolution. Released 1 Jun 2011.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,195
Mol. weight: 34.08 kDa
Released: 1 Jun 2011

Explore 3QWL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QWL contains 21 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	22-31	10
β-strand	36	1	1
α-helix	39-48	10
α-helix	50-52	3
α-helix	53-63	11
β-strand	70	1	1
α-helix	71-73	3
α-helix	74-94	21
α-helix	104-116	13
α-helix	126-128	3
α-helix	129-144	16
α-helix	148-163	16
α-helix	170-172	3
α-helix	173-184	12
α-helix	186-194	9
α-helix	198-200	3
α-helix	203-207	5
α-helix	217-228	12
α-helix	234-245	12
α-helix	247-252	6
α-helix	256-263	8
α-helix	271-286	16
α-helix	288-291	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TBC1 domain family member 7	A	protein	294	Homo sapiens	Q9P0N9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3QWL_1 TBC1 domain family member 7 (chains A)
GMTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALV
WKVLLGILPPHHESHAKVMMYRKEQYLDVLHALKVVRFVSDATPQAEVYLRMYQLESGKL
PRSPSFPLEPDDEVFLAIAKAMEEMVEDSVDCYWITRRFVNQLNTKYRDSLPQLPKAFEQ
YLNLEDGRLLTHLRMCSAAPKLPYDLWFKRCFAGCLPESSLQRVWDKVVSGSCKILVFVA
VEILLTFKIKVMALNSAEKITKFLENIPQDSSDAIVSKAIDLWHKHCGTPVHSS

Primary citation

Crystal structure of human TBC1 domain family member 7. Guan, X., Tempel, W., Tong, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q9P0N9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ULO 2.14 Å, Crystal Structure of 14-3-3 zeta in Complex with a Serine 124-phosphorylated TBC1D7…
4Z6Y 2.81 Å, Structure of the TBC1D7-TSC1 complex
9CE3 2.9 Å, Structure of the TSC:WIPI3 lysosomal recruitment complex
5EJC 3.1 Å, Crystal structural of the TSC1-TBC1D7 complex
7DL2 4.4 Å, Cryo-EM structure of human TSC complex

Browse structure collections

About this viewer

MolViewer shows 3QWL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.