5EJC: Crystal structural of the TSC1-TBC1D7 complex

Crystal structural of the TSC1-TBC1D7 complex. Determined by X-ray diffraction at 3.1 Å resolution. Released 2 Mar 2016.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 6
Atoms: 5,467
Mol. weight: 89.61 kDa
Released: 2 Mar 2016

Explore 5EJC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EJC contains 38 α-helices and 8 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	23-32	10
β-strand	36	1	1
α-helix	39-48	10
α-helix	50-52	3
α-helix	53-63	11
β-strand	70	1	1
α-helix	74-94	21
α-helix	104-115	12
α-helix	126-128	3
α-helix	129-144	16
α-helix	148-162	15
α-helix	170-172	3
α-helix	173-194	22
α-helix	203-207	5
β-strand	212	1	2
β-strand	215	1	2
α-helix	217-228	12
α-helix	234-245	12
α-helix	247-252	6
α-helix	256-263	8
α-helix	271-286	16

Chain B: 17 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	22-32	11
β-strand	36	1	3
α-helix	39-48	10
α-helix	50-52	3
α-helix	53-63	11
β-strand	70	1	3
α-helix	74-94	21
α-helix	104-115	12
α-helix	126-128	3
α-helix	129-144	16
α-helix	148-162	15
α-helix	170-172	3
α-helix	173-194	22
α-helix	203-207	5
β-strand	212	1	4
β-strand	215	1	4
α-helix	217-228	12
α-helix	234-245	12
α-helix	247-252	6
α-helix	256-263	8
α-helix	271-286	16

Chains C and E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	940-968	29

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	939-969	31

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	940-974	35

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TBC1 domain family member 7	A, B	protein	276	Homo sapiens	Q9P0N9 (AlphaFold model)
Hamartin	C, D, E, F	protein	55	Homo sapiens	Q92574 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5EJC_1 TBC1 domain family member 7 (chains A, B)
GFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVWKVLLGILPPHHESHAKV
MMYRKEQYLDVLHALKVVRFVSDATPQAEVYLRMYQLESGKLPRSPSFPLEPDDEVFLAI
AKAMEEMVEDSVDCYWITRRFVNQLNTKYRDSLPQLPKAFEQYLNLEDGRLLTHLRMCSA
APKLPYDLWFKRCFAGCLPESSLQRVWDKVVSGSCKILVFVAVEILLTFKIKVMALNSAE
KITKFLENIPQDSSDAIVSKAIDLWHKHCGTPVHSS

Sequence of entity 2 (C, D, E, F), FASTA

>5EJC_2 Hamartin (chains C, D, E, F)
GGQLQAAESRYEAQKRITQVFELEILDLYGRLEKDGLLKKLEEEKAEAAEAAEER

Primary citation

Structural Basis of the Interaction between Tuberous Sclerosis Complex 1 (TSC1) and Tre2-Bub2-Cdc16 Domain Family Member 7 (TBC1D7). Qin, J., Wang, Z., Hoogeveen-Westerveld, M. et al. J Biol Chem (2016) 291:8591-8601. DOI 10.1074/jbc.M115.701870 · PubMed

Other PDB entries of the same protein (UniProt Q9P0N9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QWL 1.9 Å, Crystal structure of human TBC1 domain family member 7
5ULO 2.14 Å, Crystal Structure of 14-3-3 zeta in Complex with a Serine 124-phosphorylated TBC1D7…
4Z6Y 2.81 Å, Structure of the TBC1D7-TSC1 complex
9CE3 2.9 Å, Structure of the TSC:WIPI3 lysosomal recruitment complex
7DL2 4.4 Å, Cryo-EM structure of human TSC complex

Browse structure collections

About this viewer

MolViewer shows 5EJC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.