3QWZ: FAF1 UBX-p97N-domain complex

Crystal structure of FAF1 UBX-p97N-domain complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 9 May 2012.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,258
Mol. weight: 33.6 kDa
Released: 9 May 2012

Explore 3QWZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QWZ contains 12 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	24-30	7	1
β-strand	38-41	4	1
α-helix	43-49	7
β-strand	53	1	2
β-strand	56-60	5	1
β-strand	66-73	8	1
β-strand	81-84	4	1
α-helix	86-91	6
β-strand	99-104	6	1
α-helix	108-109	2
β-strand	110	1	3
α-helix	111	1
β-strand	113-118	6	4
β-strand	119	1	5
α-helix	120-122	3
α-helix	130-135	6
α-helix	136-139	4
β-strand	144-147	4	3
β-strand	151-153	3	4
β-strand	162-169	8	4
β-strand	173-176	4	3
β-strand	181-183	3	4
α-helix	187-188	2
β-strand	189	1	5
α-helix	190-192	3
α-helix	193-195	3

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	573-579	7	2
β-strand	585-591	7	2
β-strand	595	1	6
α-helix	597-605	9
β-strand	613-617	5	2
β-strand	622-623	2	2
α-helix	624-626	3
β-strand	632	1	6
β-strand	641-648	8	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transitional endoplasmic reticulum ATPase	A	protein	211	Homo sapiens	P55072 (AlphaFold model)
FAS-associated factor 1	B	protein	84	Homo sapiens	Q9UNN5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3QWZ_1 Transitional endoplasmic reticulum ATPase (chains A)
GSHMASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTV
LLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVL
PIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVA
PDTVIHCEGEPIKREDEEESLNEVGYDDIGG

Sequence of entity 2 (B), FASTA

>3QWZ_2 FAS-associated factor 1 (chains B)
GSHMEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQ
LDPNKSLLEVKLFPQETLFLEAKE

Primary citation

Dissection of the interaction between FAF1 UBX and p97. Park, J.K., Jeon, H., Lee, J.J. et al. To be published.

Other PDB entries of the same protein (UniProt P55072 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5B6C 1.55 Å, Structural Details of Ufd1 binding to p97
7PUX 1.73 Å, Structure of p97 N-D1(L198W) in complex with Fragment TROLL2
3TIW 1.8 Å, Crystal structure of p97N in complex with the C-terminus of gp78
4KDL 1.81 Å, Crystal structure of p97/VCP N in complex with OTU1 UBXL
4KDI 1.86 Å, Crystal structure of p97/VCP N in complex with OTU1 UBXL
5EPP 1.88 Å, Structural Insights into the Interaction of p97 N-terminus Domain and VBM Motif in…
3EBB 1.9 Å, PLAP/P97 complex
6G2V 1.9 Å, Crystal structure of the p97 D2 domain in a helical split-washer conformation
6G2Z 1.92 Å, Crystal structure of the p97 D2 domain in a helical split-washer conformation
4KO8 1.98 Å, Structure of p97 N-D1 R155H mutant in complex with ATPgS
3QQ8 2.0 Å, Crystal structure of p97-N in complex with FAF1-UBX
6G2X 2.08 Å, Crystal structure of the p97 D2 domain in a helical split-washer conformation

Browse structure collections

About this viewer

MolViewer shows 3QWZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.