3R27: Heterogeneous nuclear ribonucleoprotein L

Crystal structure of the first RRM domain of heterogeneous nuclear ribonucleoprotein L (HnRNP L). Determined by X-ray diffraction at 2.04 Å resolution. Released 14 Sept 2011.

Method: X-ray diffraction
Resolution: 2.04 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,390
Mol. weight: 22.67 kDa
Released: 14 Sept 2011

Explore 3R27 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R27 contains 9 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	98-100	3
β-strand	103-107	5	1
α-helix	109-110	2
α-helix	115-122	8
α-helix	123-125	3
β-strand	128-134	7	1
β-strand	139-144	6	1
α-helix	147-159	13
β-strand	162-164	3	2
β-strand	167-169	3	2
β-strand	170-173	4	1

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	98-100	3
β-strand	103-107	5	3
α-helix	109-110	2
α-helix	115-122	8
β-strand	128-134	7	3
β-strand	139-144	6	3
α-helix	147-159	13
β-strand	162-164	3	4
β-strand	167-169	3	4
β-strand	170-173	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heterogeneous nuclear ribonucleoprotein L	A, B	protein	100	Homo sapiens	P14866 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3R27_1 Heterogeneous nuclear ribonucleoprotein L (chains A, B)
MGHHHHHHMENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQA
LVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKIS

Primary citation

Crystal structure of the first RRM domain of heterogeneous nuclear ribonucleoprotein L (HnRNP L). Zhang, W., Liu, Y., Zeng, F. et al. To be published.

Other PDB entries of the same protein (UniProt P14866 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EVR 1.8 Å, Crystal structure of hnRNP L RRM2 in complex with SETD2
3TO8 1.82 Å, Crystal structure of the two C-terminal RRM domains of heterogeneous nuclear…

Browse structure collections

About this viewer

MolViewer shows 3R27 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.