Crystal structure of the two C-terminal RRM domains of heterogeneous nuclear ribonucleoprotein L (hnRNP L). Determined by X-ray diffraction at 1.82 Å resolution. Released 7 Mar 2012.
Explore 3TO8 in 3D Show helices and sheets RCSB PDB PDBe
3TO8 contains 6 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 383-387 | 5 | 1 |
| α-helix | 396-403 | 8 | |
| β-strand | 409-414 | 6 | 1 |
| β-strand | 421-426 | 6 | 1 |
| α-helix | 429-439 | 11 | |
| β-strand | 442-444 | 3 | 2 |
| β-strand | 447-449 | 3 | 2 |
| β-strand | 450-453 | 4 | 1 |
| β-strand | 466 | 1 | 3 |
| β-strand | 472 | 1 | 3 |
| β-strand | 474-476 | 3 | 1 |
| α-helix | 488-491 | 4 | |
| β-strand | 502-508 | 7 | 4 |
| α-helix | 514-524 | 11 | |
| α-helix | 527-529 | 3 | |
| β-strand | 531-534 | 4 | 4 |
| β-strand | 543-548 | 6 | 4 |
| α-helix | 552-562 | 11 | |
| β-strand | 566-567 | 2 | 5 |
| β-strand | 576-577 | 2 | 5 |
| β-strand | 579-582 | 4 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heterogeneous nuclear ribonucleoprotein L | A | protein | 218 | Homo sapiens | P14866 (AlphaFold model) |
>3TO8_1 Heterogeneous nuclear ribonucleoprotein L (chains A) MGHHHHHHDSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYA VDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYGLEDGSCSYKDFSESRNNRFSTPEQA AKNRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSERSSSGLLEWES KSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQHAS
Crystal structure of the two C-terminal RRM domains of heterogeneous nuclear ribonucleoprotein L (hnRNP L). Zhang, W.J., Zeng, F.X., Liu, Y.W. et al. To be published.
Other PDB entries of the same protein (UniProt P14866 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3TO8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.