7EVR: HnRNP L RRM2

Crystal structure of hnRNP L RRM2 in complex with SETD2. Determined by X-ray diffraction at 1.8 Å resolution. Released 20 Oct 2021.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,279
Mol. weight: 30.83 kDa
Released: 20 Oct 2021

Explore 7EVR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EVR contains 5 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	194-200	7	1
α-helix	208-215	8
β-strand	221-227	7	1
β-strand	232-238	7	1
α-helix	241-251	11
β-strand	255-257	3	1
β-strand	260-267	8	1
β-strand	282-284	3	1

Chain B: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2174-2175	2	1
β-strand	2179	1	2
β-strand	2182	1	2
β-strand	2187-2188	2	1

Chain C: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	194-200	7	3
α-helix	208-215	8
α-helix	216-218	3
β-strand	221-227	7	3
β-strand	233-238	6	3
α-helix	241-251	11
β-strand	255-257	3	3
β-strand	260-267	8	3
β-strand	282-284	3	3

Chain D: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2174	1	3
β-strand	2179	1	4
β-strand	2182	1	4
β-strand	2188	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heterogeneous nuclear ribonucleoprotein L	A, C	protein	111	Homo sapiens	P14866 (AlphaFold model)
SHI domain from Histone-lysine N-methyltransferase SETD2	B, D	protein	26	Homo sapiens	Q9BYW2 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7EVR_1 Heterogeneous nuclear ribonucleoprotein L (chains A, C)
HHHHHHMDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEF
DSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPN

Sequence of entity 2 (B, D), FASTA

>7EVR_2 SHI domain from Histone-lysine N-methyltransferase SETD2 (chains B, D)
YPPGYPMQAYVDPSNPNAGKVLLPTP

Primary citation

Structural basis of the interaction between SETD2 methyltransferase and hnRNP L paralogs for governing co-transcriptional splicing. Bhattacharya, S., Wang, S., Reddy, D. et al. Nat Commun (2021) 12:6452-6452. DOI 10.1038/s41467-021-26799-3 · PubMed

Other PDB entries of the same protein (UniProt P14866 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TO8 1.82 Å, Crystal structure of the two C-terminal RRM domains of heterogeneous nuclear…
3R27 2.04 Å, Crystal structure of the first RRM domain of heterogeneous nuclear ribonucleoprotein L…

Browse structure collections

About this viewer

MolViewer shows 7EVR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.