Caspase-2 bound to one copy of Ac-DVAD-CHO. Determined by X-ray diffraction at 1.8 Å resolution. Released 27 Jul 2011.
Explore 3R7B in 3D Show helices and sheets RCSB PDB PDBe
3R7B contains 22 α-helices and 37 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 177-180 | 4 | |
| α-helix | 181-187 | 7 | |
| α-helix | 188-190 | 3 | |
| β-strand | 191 | 1 | 1 |
| β-strand | 200-206 | 7 | 2 |
| α-helix | 222-235 | 14 | |
| β-strand | 239-244 | 6 | 2 |
| α-helix | 248-259 | 12 | |
| α-helix | 262-265 | 4 | |
| β-strand | 269-275 | 7 | 2 |
| β-strand | 278-279 | 2 | 3 |
| β-strand | 282-284 | 3 | 3 |
| β-strand | 290-292 | 3 | 3 |
| α-helix | 293-299 | 7 | |
| α-helix | 306-308 | 3 | |
| β-strand | 313-318 | 6 | 2 |
| α-helix | 324-325 | 2 | |
| β-strand | 326 | 1 | 4 |
| β-strand | 329-330 | 2 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 357-358 | 2 | 6 |
| β-strand | 364-368 | 5 | 2 |
| α-helix | 375-377 | 3 | |
| β-strand | 378-379 | 2 | 7 |
| β-strand | 383-384 | 2 | 7 |
| α-helix | 385-397 | 13 | |
| α-helix | 403-416 | 14 | |
| β-strand | 430 | 1 | 4 |
| β-strand | 434-437 | 4 | 2 |
| β-strand | 442 | 1 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 177-180 | 4 | |
| α-helix | 181-187 | 7 | |
| α-helix | 188-190 | 3 | |
| β-strand | 191 | 1 | 8 |
| β-strand | 200-206 | 7 | 2 |
| α-helix | 222-235 | 14 | |
| β-strand | 238-244 | 7 | 2 |
| α-helix | 248-259 | 12 | |
| α-helix | 262-266 | 5 | |
| β-strand | 269-275 | 7 | 2 |
| β-strand | 278-279 | 2 | 9 |
| β-strand | 282-284 | 3 | 9 |
| β-strand | 290-292 | 3 | 9 |
| α-helix | 293-298 | 6 | |
| α-helix | 306-308 | 3 | |
| β-strand | 313-318 | 6 | 2 |
| β-strand | 324 | 1 | 10 |
| β-strand | 326 | 1 | 11 |
| β-strand | 329-330 | 2 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 357-358 | 2 | 5 |
| β-strand | 364-368 | 5 | 2 |
| β-strand | 374 | 1 | 10 |
| β-strand | 377-379 | 3 | 12 |
| β-strand | 383-384 | 2 | 12 |
| α-helix | 385-397 | 13 | |
| α-helix | 403-416 | 14 | |
| β-strand | 430 | 1 | 11 |
| β-strand | 434-437 | 4 | 2 |
| β-strand | 442 | 1 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 404-405 | 2 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Caspase-2 subunit p18 | A, C | protein | 160 | Homo sapiens | P42575 (AlphaFold model) |
| Caspase-2 subunit p12 | B, D | protein | 112 | Homo sapiens | P42575 (AlphaFold model) |
| Peptide Inhibitor (ACE)DVAD-CHO | F | protein | 5 |
>3R7B_1 Caspase-2 subunit p18 (chains A, C) MQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLF KLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQL QEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQD
>3R7B_2 Caspase-2 subunit p12 (chains B, D) GKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLV KVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPTLEHHHHHH
>3R7B_3 Peptide Inhibitor (ACE)DVAD-CHO (chains F) XDVAD
Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis. Tang, Y., Wells, J.A., Arkin, M.R. J Biol Chem (2011) 286:34147-34154. DOI 10.1074/jbc.M111.247627 · PubMed
Other PDB entries of the same protein (UniProt P42575 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3R7B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.