3RK2: Truncated SNARE complex
Truncated SNARE complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 27 Jul 2011.
- Method
- X-ray diffraction
- Resolution
- 2.2 Å
- Organisms
- Homo sapiens, Rattus norvegicus
- Chains
- 8
- Atoms
- 3,825
- Mol. weight
- 57.63 kDa
- Ligands
- CA
- Released
- 27 Jul 2011
Explore 3RK2 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3RK2 contains 8 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 32-59 | 28 | |
Chains B and F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 191-247 | 57 | |
Chains C and G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-80 | 73 | |
Chains D and H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 140-200 | 61 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 30-59 | 30 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Vesicle-associated membrane protein 2 | A, E | protein | 37 | Homo sapiens | P63027 (AlphaFold model) |
| Syntaxin-1A | B, F | protein | 65 | Rattus norvegicus | P32851 (AlphaFold model) |
| Synaptosomal-associated protein 25 | C, G | protein | 81 | Homo sapiens | P60880 (AlphaFold model) |
| Synaptosomal-associated protein 25 | D, H | protein | 65 | Homo sapiens | P60880 (AlphaFold model) |
Sequence of entity 1 (A, E), FASTA
>3RK2_1 Vesicle-associated membrane protein 2 (chains A, E)
GPLGSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
Sequence of entity 2 (B, F), FASTA
>3RK2_2 Syntaxin-1A (chains B, F)
GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAV
SDTKK
Sequence of entity 3 (C, G), FASTA
>3RK2_3 Synaptosomal-associated protein 25 (chains C, G)
GSHMMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEE
GMNHINQDMKEAEKNLKDLGW
Sequence of entity 4 (D, H), FASTA
>3RK2_4 Synaptosomal-associated protein 25 (chains D, H)
GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQR
ATKML
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CA | Calcium ion | Ca | 4 |
Primary citation
Complexin cross-links prefusion SNAREs into a zigzag array. Kummel, D., Krishnakumar, S.S., Radoff, D.T. et al. Nat Struct Mol Biol (2011) 18:927-933. DOI 10.1038/nsmb.2101 · PubMed
Other PDB entries of the same protein (UniProt P63027 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9CKX 1.98 Å, Crystal structure of Dsk2 Sti1 domain bound to a transmembrane domain
- 3FIE 2.1 Å, Crystal structure of Clostridium botulinum neurotoxin serotype F catalytic domain with…
- 3FII 2.17 Å, Crystal structure of Clostridium botulinum neurotoxin serotype F catalytic domain with…
- 3RK3 3.5 Å, Truncated SNARE complex with complexin
- 7UDC 3.7 Å, cryo-EM structures of a synaptobrevin-Munc18-1-syntaxin-1 complex class1
- 3RL0 3.8 Å, Truncated SNARE complex with complexin (P1)
Browse structure collections
About this viewer
MolViewer shows 3RK2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.