3RN5: Interferon-inducible protein AIM2

Structural basis of cytosolic DNA recognition by innate immune receptors. Determined by X-ray diffraction at 2.5 Å resolution. Released 25 Apr 2012.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 8
Atoms: 7,944
Mol. weight: 117.78 kDa
Released: 25 Apr 2012

Explore 3RN5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RN5 contains 26 α-helices and 65 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	150	1	1
β-strand	154-161	8	2
β-strand	165-169	5	3
β-strand	172-176	5	3
β-strand	177-182	6	2
β-strand	187-192	6	2
α-helix	195-199	5
β-strand	206-210	5	2
β-strand	212	1	1
β-strand	213-214	2	2
β-strand	219-221	3	2
β-strand	226-229	4	2
α-helix	230-231	2
α-helix	240-247	8
α-helix	249-251	3
α-helix	252-256	5
α-helix	259	1
β-strand	263-275	13	4
β-strand	279-286	8	4
β-strand	289-296	8	4
α-helix	300-302	3
β-strand	309-319	11	4
β-strand	324-327	4	4
β-strand	333-337	5	4

Chain B: 6 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	150	1	5
β-strand	155-161	7	6
β-strand	165-168	4	7
β-strand	173-176	4	7
β-strand	177-182	6	6
β-strand	187-192	6	6
α-helix	195-199	5
β-strand	206-210	5	6
β-strand	212	1	5
β-strand	218-221	4	6
β-strand	226-229	4	6
α-helix	240-247	8
α-helix	249-251	3
α-helix	252-256	5
α-helix	259	1
β-strand	263-275	13	8
β-strand	279-286	8	8
β-strand	289-296	8	8
α-helix	300-302	3
β-strand	306	1	9
β-strand	308	1	9
β-strand	309-319	11	8
β-strand	325-327	3	8
β-strand	333-337	5	8

Chain C: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	150-161	12	10
β-strand	165-167	3	11
β-strand	174-176	3	11
β-strand	177-182	6	10
β-strand	187-192	6	10
α-helix	197-200	4
β-strand	206-212	7	10
β-strand	218-221	4	10
β-strand	226-229	4	10
α-helix	237-239	3
α-helix	240-247	8
α-helix	248-251	4
α-helix	252-255	4
α-helix	258-259	2
β-strand	263-275	13	12
β-strand	279-286	8	12
β-strand	289-296	8	12
α-helix	301-303	3
β-strand	309-317	9	12
β-strand	325-327	3	12
β-strand	333-337	5	12

Chain D: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	150	1	13
β-strand	154-161	8	14
β-strand	165-168	4	15
β-strand	173-176	4	15
β-strand	177-182	6	14
β-strand	187-192	6	14
α-helix	197-200	4
β-strand	206-210	5	14
β-strand	212	1	13
β-strand	213-214	2	14
β-strand	219-221	3	14
β-strand	226-229	4	14
α-helix	240-247	8
α-helix	248-251	4
α-helix	252-255	4
α-helix	259	1
β-strand	262-275	14	16
β-strand	279-286	8	16
β-strand	289-296	8	16
α-helix	301-303	3
β-strand	309-319	11	16
β-strand	324-337	14	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon-inducible protein AIM2	A, B, C, D	protein	208	Homo sapiens	O14862 (AlphaFold model)
DNA (5'-d(cpcpaptpcpapapapgpapgpapgpapapapgpap*g)-3')	K, M	DNA	19
DNA (5'-d(gpcptpcptptptpcptpcptpcptptptpgpaptp*g)-3')	L, N	DNA	19

Sequence of entity 1 (A, B, C, D), FASTA

>3RN5_1 Interferon-inducible protein AIM2 (chains A, B, C, D)
GSVDSIREGFQKRCLPVMVLKAKKPFTFETQEGKQEMFHATVATEKEFFFVKVFNTLLKD
KFIPKRIIIIARYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRKAGETPKINTLQTQP
LGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMKCKEGDKVRLTFFTLSK
NGEKLQLTSGVHSTIKVIKAKKKTAAAS

Sequence of entity 2 (K, M), FASTA

>3RN5_2 DNA (5'-D(*CP*CP*AP*TP*CP*AP*AP*AP*GP*AP*GP*AP*GP*AP*AP*AP*GP*AP*G)-3') (chains K, M)
CCATCAAAGAGAGAAAGAG

Sequence of entity 3 (L, N), FASTA

>3RN5_3 DNA (5'-D(*GP*CP*TP*CP*TP*TP*TP*CP*TP*CP*TP*CP*TP*TP*TP*GP*AP*TP*G)-3') (chains L, N)
GCTCTTTCTCTCTTTGATG

Primary citation

Structures of the HIN Domain:DNA Complexes Reveal Ligand Binding and Activation Mechanisms of the AIM2 Inflammasome and IFI16 Receptor. Jin, T., Perry, A., Jiang, J. et al. Immunity (2012) 36:561-571. DOI 10.1016/j.immuni.2012.02.014 · PubMed

Other PDB entries of the same protein (UniProt O14862 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4O7Q 1.82 Å, Crystal Structure of the F27G AIM2 Pyrin Domain Mutant and Similarities of its…
3VD8 2.07 Å, Crystal structure of human AIM2 PYD domain with MBP fusion
3RN2 2.55 Å, Structural Basis of Cytosolic DNA Recognition by Innate Immune Receptors
7K3R 3.2 Å, Cryo-EM structure of AIM2-PYD filament
6MB2 5.0 Å, Cryo-EM structure of the PYD filament of AIM2

Browse structure collections

About this viewer

MolViewer shows 3RN5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.