6FFA: FMDV Leader protease

FMDV Leader protease bound to substrate ISG15. Determined by X-ray diffraction at 1.5 Å resolution. Released 21 Feb 2018.

Method: X-ray diffraction
Resolution: 1.5 Å
Organisms: Foot-and-mouth disease virus, Homo sapiens
Chains: 2
Atoms: 2,142
Mol. weight: 28.61 kDa
Released: 21 Feb 2018

Explore 6FFA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FFA contains 11 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	1
β-strand	33	1	2
β-strand	38-40	3	1
α-helix	51-63	13
α-helix	69-72	4
α-helix	79-90	12
α-helix	100-107	8
α-helix	108-110	3
β-strand	115-117	3	2
β-strand	124-126	3	2
α-helix	134-136	3
β-strand	137-143	7	2
β-strand	149-155	7	2
β-strand	158-163	6	2
β-strand	166-169	4	2
α-helix	174-176	3
β-strand	177-182	6	2

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	82-87	6	3
β-strand	93-98	6	3
β-strand	103	1	4
α-helix	104-115	12
α-helix	119-121	3
β-strand	122-126	5	3
β-strand	129-130	2	3
α-helix	131-132	2
β-strand	136	1	4
α-helix	137-140	4
β-strand	147-152	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lbpro	A	protein	167	Foot-and-mouth disease virus	P03305
Ubiquitin-like protein ISG15	B	protein	78	Homo sapiens	P05161 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6FFA_1 Lbpro (chains A)
MELTLYNGEKKTFYSRPNNHDNCWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLED
LTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEH
AVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQEPLNGEWKAK

Sequence of entity 2 (B), FASTA

>6FFA_2 Ubiquitin-like protein ISG15 (chains B)
MDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPL
GEYGLKPLSTVFMNLRLX

Primary citation

Irreversible inactivation of ISG15 by a viral leader protease enables alternative infection detection strategies. Swatek, K.N., Aumayr, M., Pruneda, J.N. et al. Proc Natl Acad Sci U S A (2018) 115:2371-2376. DOI 10.1073/pnas.1710617115 · PubMed

Other PDB entries of the same protein (UniProt P03305), best resolution first:

4QBB 1.6 Å, Structure of the foot-and-mouth disease virus leader proteinase in complex with…
9HV9 1.8 Å, Crystal structure of Fab34 complexed with a 7-mer peptide of FMDV VP1
1QMY 1.9 Å, Fmdv leader protease (lbshort-C51A-C133S)
1QQP 1.9 Å, Foot-and-mouth disease virus/ oligosaccharide receptor complex.
1QOL 3.0 Å, Structure of the fmdv leader protease
9HVA 3.89 Å, Crystal structure of Fab34 complexed with a 18-mer peptide of FMDV VP1
2JQF Full Length Leader Protease of Foot and Mouth Disease Virus C51A Mutant
2JQG Leader Protease

Browse structure collections

About this viewer

MolViewer shows 6FFA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.