3S3X: Chicken acid-sensing ion channel 1

Structure of chicken acid-sensing ion channel 1 AT 3.0 A resolution in complex with psalmotoxin. Determined by X-ray diffraction at 2.99 Å resolution. Released 23 May 2012.

Method: X-ray diffraction
Resolution: 2.99 Å
Organisms: Gallus gallus, Psalmopoeus cambridgei
Chains: 6
Atoms: 10,519
Mol. weight: 172.44 kDa
Ligands: NAG
Released: 23 May 2012

Explore 3S3X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3S3X contains 78 α-helices and 70 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	47-60	14
α-helix	63-66	4
β-strand	74-81	8	1
β-strand	86-87	2	2
α-helix	88-89	2
β-strand	90-95	6	3
α-helix	106-112	7
α-helix	133-140	8
α-helix	155-162	8
α-helix	166-169	4
β-strand	170-175	6	1
β-strand	178-179	2	1
α-helix	182-184	3
β-strand	185-190	6	3
β-strand	193-198	6	3
α-helix	205-208	4
β-strand	209-210	2	2
α-helix	215-217	3
β-strand	219-224	6	1
α-helix	227-229	3
α-helix	231-232	2
β-strand	244	1	4
β-strand	246-251	6	3
α-helix	259-262	4
β-strand	264-266	3	3
β-strand	270-282	13	1
α-helix	306-322	17
β-strand	325	1	5
α-helix	333-334	2
β-strand	335	1	5
α-helix	336-337	2
α-helix	338-340	3
α-helix	341-345	5
α-helix	346-350	5
α-helix	351-355	5
α-helix	362-365	4
β-strand	367-379	13	1
α-helix	386-392	7
α-helix	397-403	7
β-strand	404-423	20	1
α-helix	427-435	9
α-helix	438-447	10

Chain B: 24 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	51-55	5
α-helix	65-69	5
β-strand	74-81	8	6
β-strand	86-87	2	7
α-helix	88-89	2
β-strand	90-95	6	8
α-helix	106-112	7
α-helix	133-140	8
α-helix	155-162	8
α-helix	166-169	4
β-strand	170-175	6	6
β-strand	178-179	2	6
α-helix	182-184	3
β-strand	185-190	6	8
β-strand	193-198	6	8
α-helix	205-208	4
β-strand	209-210	2	7
α-helix	215-217	3
β-strand	219-224	6	6
α-helix	227-229	3
α-helix	231-232	2
β-strand	244	1	1
β-strand	246-251	6	8
α-helix	259-262	4
β-strand	264-266	3	8
β-strand	270-282	13	6
α-helix	284-285	2
β-strand	292	1	9
α-helix	306-322	17
β-strand	325	1	10
α-helix	333-334	2
β-strand	335	1	10
α-helix	336-337	2
α-helix	338-340	3
α-helix	341-345	5
α-helix	346-354	9
α-helix	362-364	3
β-strand	365	1	9
β-strand	367-379	13	6
α-helix	386-392	7
α-helix	397-403	7
β-strand	404-423	20	6
α-helix	427-441	15

Chain C: 23 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	51-70	20
β-strand	74-81	8	4
β-strand	86-87	2	11
α-helix	88-89	2
β-strand	90-95	6	12
α-helix	106-112	7
α-helix	133-140	8
α-helix	155-162	8
α-helix	166-169	4
β-strand	170-175	6	4
β-strand	178-179	2	4
α-helix	182-184	3
β-strand	185-190	6	12
β-strand	193-198	6	12
α-helix	205-208	4
β-strand	209-210	2	11
α-helix	215-217	3
β-strand	219-224	6	4
α-helix	227-229	3
α-helix	231-232	2
β-strand	244	1	6
β-strand	246-251	6	12
α-helix	259-262	4
β-strand	264-266	3	12
β-strand	270-282	13	4
α-helix	284-285	2
β-strand	292	1	13
α-helix	306-322	17
β-strand	325	1	14
α-helix	334	1
β-strand	335	1	14
α-helix	336-337	2
α-helix	338-340	3
α-helix	341-345	5
α-helix	346-354	9
α-helix	362-364	3
β-strand	365	1	13
β-strand	367-379	13	4
α-helix	386-392	7
α-helix	397-403	7
β-strand	404-423	20	4
α-helix	427-448	22

Chains D, E and F: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	15
β-strand	9	1	16
β-strand	17	1	15
α-helix	18	1
β-strand	21-24	4	16
α-helix	25-26	2
β-strand	32-35	4	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amiloride-sensitive cation channel 2, neuronal	A, B, C	protein	459	Gallus gallus	Q1XA76 (AlphaFold model)
Psalmotoxin-1	D, E, F	protein	37	Psalmopoeus cambridgei	P60514 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3S3X_1 Amiloride-sensitive cation channel 2, neuronal (chains A, B, C)
MSYYHHHHHHGASLVPRGSHMSTLHGISHIFSYERLSLKRVVWALCFMGSLALLALVCTN
RIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYE
IPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPED
FKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEA
GIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTY
SITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEM
PCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKA
YEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHR

Sequence of entity 2 (D, E, F), FASTA

>3S3X_2 Psalmotoxin-1 (chains D, E, F)
DCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTP

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6

Water and common crystallization additives (SO4, CL, K) are not listed.

Primary citation

Structure of the Acid-sensing ion channel 1 in complex with the gating modifier Psalmotoxin 1. Dawson, R.J., Benz, J., Stohler, P. et al. Nat Commun (2012) 3:936-936. DOI 10.1038/ncomms1917 · PubMed

Other PDB entries of the same protein (UniProt Q1XA76 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QTS 1.9 Å, Structure of an acid-sensing ion channel 1 at 1.9 A resolution and low pH
4NTW 2.07 Å, Structure of acid-sensing ion channel in complex with snake toxin
4NTX 2.27 Å, Structure of acid-sensing ion channel in complex with snake toxin and amiloride
3S3W 2.6 Å, Structure of chicken acid-sensing ion channel 1 at 2.6 a resolution and ph 7.5
4NTY 2.65 Å, Cesium sites in the crystal structure of acid-sensing ion channel in complex with snake…
4FZ0 2.8 Å, Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at low pH
6VTK 2.82 Å, Structure of an acid-sensing ion channel solubilized by styrene maleic acid and in a…
5WKU 2.95 Å, Structure of an acid sensing ion channel in a resting state with barium
3IJ4 3.0 Å, Cesium sites in the crystal structure of a functional acid sensing ion channel in the…
4NYK 3.0 Å, Structure of a membrane protein
6X9H 3.01 Å, Molecular mechanism and structural basis of small-molecule modulation of acid-sensing…
5WKV 3.2 Å, Structure of an acid sensing ion channel in a resting state with calcium

Browse structure collections

About this viewer

MolViewer shows 3S3X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.