3S92: Second bromodomain of human BRD3

Crystal Structure of the second bromodomain of human BRD3 in complex with the inhibitor JQ1. Determined by X-ray diffraction at 1.36 Å resolution. Released 29 Jun 2011.

Method: X-ray diffraction
Resolution: 1.36 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,190
Mol. weight: 13.83 kDa
Ligands: JQ1
Released: 29 Jun 2011

Explore 3S92 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3S92 contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	310-323	14
α-helix	325-327	3
α-helix	328-331	4
α-helix	332-334	3
α-helix	348-351	4
α-helix	358-366	9
α-helix	373-390	18
α-helix	396-413	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 3	A	protein	113	Homo sapiens	Q15059 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3S92_1 Bromodomain-containing protein 3 (chains A)
SMGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKR
KMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMP

Ligands and cofactors

ID	Name	Formula	Copies
JQ1	(6S)-6-(2-tert-butoxy-2-oxoethyl)-4-(4-chlorophenyl)-2,3,9-trimethyl-6,7-dihydr…	C23 H26 Cl N4 O2 S	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Crystal Structure of the second bromodomain of human BRD3 in complex with the inhibitor JQ1. Filippakopoulos, P., Picaud, S., Qi, J. et al. To be published.

Other PDB entries of the same protein (UniProt Q15059 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QJU 1.2 Å, Crystal structure of human Bromodomain containing protein 3 (BRD3) in complex with…
9NN4 1.37 Å, BET BRD3-BD1 in complex with peptide 7.2
2NXB 1.4 Å, Crystal structure of human Bromodomain containing protein 3 (BRD3)
7TOA 1.41 Å, BRD3-BD1 in complex with RaPID linear peptide 3xAcK.1 (triAcK.1)
7LAY 1.45 Å, Crystal structure of the first bromodomain (BD1) of human BRD3 bound to SG3-179
8CV5 1.47 Å, Peptide 4.2B in complex with BRD3.2
7L72 1.5 Å, Crystal structure of the second bromodomain (BD2) of human BRD3 bound to Ro3280
7RJL 1.5 Å, Crystal structure of human Bromodomain containing protein 3 (BRD3) in complex with SHMT
7TO8 1.5 Å, BRD3-BD1 in complex with RaPID linear peptide 2xAcK.1 (diAcK.1)
7L9L 1.55 Å, Crystal structure of the second bromodomain (BD2) of human BRD3 bound to BI2536
7TO9 1.6 Å, BRD3-BD1 in complex with RaPID linear peptide 2xAcK.4xE (diAcK.4xE)
9MPN 1.6 Å, BRD3-BD1 A128T mutant

Browse structure collections

About this viewer

MolViewer shows 3S92 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.