Crystal structure of the second bromodomain (BD2) of human BRD3 bound to BI2536. Determined by X-ray diffraction at 1.55 Å resolution. Released 7 Jul 2021.
Explore 7L9L in 3D Show helices and sheets RCSB PDB PDBe
7L9L contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 307-323 | 17 | |
| α-helix | 325-327 | 3 | |
| α-helix | 328-331 | 4 | |
| α-helix | 332-334 | 3 | |
| α-helix | 348-351 | 4 | |
| α-helix | 358-366 | 9 | |
| α-helix | 373-390 | 18 | |
| α-helix | 396-413 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bromodomain-containing protein 3 | A | protein | 113 | Homo sapiens | Q15059 (AlphaFold model) |
>7L9L_1 Bromodomain-containing protein 3 (chains A) SMGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKR KMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMP
| ID | Name | Formula | Copies |
|---|---|---|---|
| R78 | 4-{[(7R)-8-cyclopentyl-7-ethyl-5-methyl-6-oxo-5,6,7,8-tetrahydropteridin-2-yl]a… | C28 H39 N7 O3 | 1 |
Water and common crystallization additives (EDO) are not listed.
Differential BET Bromodomain Inhibition by Dihydropteridinone and Pyrimidodiazepinone Kinase Inhibitors. Karim, R.M., Bikowitz, M.J., Chan, A. et al. J Med Chem (2021) 64:15772-15786. DOI 10.1021/acs.jmedchem.1c01096 · PubMed
Other PDB entries of the same protein (UniProt Q15059 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7L9L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.