human IFNAR1. Determined by X-ray diffraction at 1.9 Å resolution. Released 31 Aug 2011.
Explore 3S98 in 3D Show helices and sheets RCSB PDB PDBe
3S98 contains 12 α-helices and 27 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-14 | 5 | 1 |
| β-strand | 17-21 | 5 | 1 |
| β-strand | 33-40 | 8 | 2 |
| β-strand | 47-48 | 2 | 2 |
| α-helix | 49 | 1 | |
| β-strand | 55 | 1 | 2 |
| β-strand | 59-61 | 3 | 1 |
| β-strand | 73-80 | 8 | 2 |
| β-strand | 85-89 | 5 | 2 |
| β-strand | 93 | 1 | 2 |
| α-helix | 95-98 | 4 | |
| β-strand | 100 | 1 | 1 |
| α-helix | 101-104 | 4 | |
| β-strand | 105-110 | 6 | 3 |
| β-strand | 115-120 | 6 | 3 |
| β-strand | 137-144 | 8 | 4 |
| β-strand | 151-156 | 6 | 4 |
| β-strand | 159-162 | 4 | 3 |
| α-helix | 165-166 | 2 | |
| β-strand | 170-179 | 10 | 4 |
| α-helix | 180-182 | 3 | |
| β-strand | 184-185 | 2 | 4 |
| α-helix | 187-191 | 5 | |
| β-strand | 192-195 | 4 | 4 |
| α-helix | 199-200 | 2 | |
| α-helix | 203-205 | 3 | |
| β-strand | 206-213 | 8 | 5 |
| β-strand | 216-222 | 7 | 5 |
| β-strand | 229-236 | 8 | 6 |
| α-helix | 237-240 | 4 | |
| β-strand | 251-252 | 2 | 6 |
| α-helix | 254-256 | 3 | |
| β-strand | 259 | 1 | 6 |
| β-strand | 263-267 | 5 | 5 |
| α-helix | 268-270 | 3 | |
| β-strand | 275-283 | 9 | 6 |
| β-strand | 288 | 1 | 6 |
| α-helix | 289-294 | 6 | |
| β-strand | 295-298 | 4 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interferon alpha/beta receptor 1 | A | protein | 306 | Homo sapiens | P17181 (AlphaFold model) |
>3S98_1 Interferon alpha/beta receptor 1 (chains A) ADPLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGMDNWIKLSGCQNITSTK CNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHLEAEDKAIVIHI SPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERIENIYSRHKIYKLSPETTYCLKVKAAL LTSWKIGVYSPVHCIKTTVENELPPPENIEVSVQNQNYVLKWDYTYANMTFQVQWLHAFL KRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDT EIQAFL
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Structural linkage between ligand discrimination and receptor activation by type I interferons. Thomas, C., Moraga, I., Levin, D. et al. Cell (2011) 146:621-632. DOI 10.1016/j.cell.2011.06.048 · PubMed
Other PDB entries of the same protein (UniProt P17181 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3S98 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.