3SDL: Human ISG15

Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza B virus, Northeast Structural Genomics Consortium Target IDs HX6481, HR2873, and OR2. Determined by X-ray diffraction at 2.29 Å resolution. Released 20 Jul 2011.

Method: X-ray diffraction
Resolution: 2.29 Å
Organisms: Influenza B virus, Homo sapiens
Chains: 4
Atoms: 4,018
Mol. weight: 62.41 kDa
Released: 20 Jul 2011

Explore 3SDL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SDL contains 25 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	16-36	21
α-helix	42-64	23
α-helix	68-70	3
α-helix	74-90	17
α-helix	97-99	3

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	16-35	20
α-helix	42-63	22
α-helix	74-90	17

Chain C: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	1
β-strand	14-17	4	1
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	1
α-helix	52	1
β-strand	53	1	1
α-helix	54	1
β-strand	70-75	6	1
β-strand	82-87	6	2
β-strand	93-98	6	2
β-strand	103	1	3
α-helix	104-115	12
α-helix	119-121	3
β-strand	122-126	5	2
β-strand	129-130	2	2
α-helix	131-132	2
β-strand	136	1	3
α-helix	137-140	4
β-strand	147-152	6	2

Chain D: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	4
β-strand	14-17	4	4
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	4
α-helix	52	1
β-strand	53	1	4
α-helix	54-55	2
α-helix	60-62	3
β-strand	70-75	6	4
β-strand	82-87	6	5
β-strand	93-98	6	5
β-strand	103	1	6
α-helix	104-115	12
α-helix	119-121	3
β-strand	122-126	5	5
β-strand	129-130	2	5
α-helix	131	1
β-strand	136	1	6
α-helix	137-140	4
β-strand	147-152	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 1	A, B	protein	113	Influenza B virus	P03502 (AlphaFold model)
Ubiquitin-like protein ISG15	C, D	protein	164	Homo sapiens	P05161 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3SDL_1 Non-structural protein 1 (chains A, B)
MGHHHHHHSHMADNMTTTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHR
LKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPY

Sequence of entity 2 (C, D), FASTA

>3SDL_2 Ubiquitin-like protein ISG15 (chains C, D)
SHHHHHHMGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVA
LQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSG
LEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Primary citation

Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus. Guan, R., Ma, L.C., Leonard, P.G. et al. Proc Natl Acad Sci U S A (2011) 108:13468-13473. DOI 10.1073/pnas.1107032108 · PubMed

Other PDB entries of the same protein (UniProt P03502 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S8S 1.87 Å, Crystal Structure of HLA A*1101 in complex with RVLVNGTFLK, an 10-mer epitope from…
3RT3 2.01 Å, Complex of influenza virus protein with host anti-viral factor
1XEQ 2.1 Å, Crystal tructure of RNA binding domain of influenza B virus non-structural protein
3R66 2.3 Å, Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza…
6JH0 2.4 Å, Crystal structure of cISG15/NS1B complex
6J62 2.49 Å, Crystal structure of mISG15/NS1B complex
6JH1 3.0 Å, Crystal structure of bISG15/NS1B complex

Browse structure collections

About this viewer

MolViewer shows 3SDL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.