Crystal structure of the FYVE domain of endofin (ZFYVE16) at 1.1A resolution. Determined by X-ray diffraction at 1.09 Å resolution. Released 31 Aug 2011.
Explore 3T7L in 3D Show helices and sheets RCSB PDB PDBe
3T7L contains 5 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 741-746 | 6 | |
| α-helix | 747-749 | 3 | |
| β-strand | 752 | 1 | 1 |
| α-helix | 758 | 1 | |
| β-strand | 759 | 1 | 1 |
| α-helix | 760 | 1 | |
| β-strand | 767-768 | 2 | 2 |
| β-strand | 775-776 | 2 | 2 |
| β-strand | 783-787 | 5 | 3 |
| β-strand | 792-796 | 5 | 3 |
| α-helix | 798-807 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Zinc finger FYVE domain-containing protein 16 | A | protein | 90 | Homo sapiens | Q7Z3T8 (AlphaFold model) |
>3T7L_1 Zinc finger FYVE domain-containing protein 16 (chains A) SMEGLVLGQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVCCNRKCKLQYL EKEARVCVVCYETISKAQAFERMMSPTGSN
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (EDO) are not listed.
Crystal structure of the FYVE domain of endofin (ZFYVE16) at 1.1A resolution. Chaikuad, A., Williams, E., Guo, K. et al. To be published.
Other PDB entries of the same protein (UniProt Q7Z3T8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3T7L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.