Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1 domain (Endofin peptide complex). Determined by X-ray diffraction at 1.76 Å resolution. Released 16 Aug 2017.
Explore 5MK0 in 3D Show helices and sheets RCSB PDB PDBe
5MK0 contains 40 α-helices and 6 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-16 | 4 | |
| β-strand | 17-20 | 4 | 1 |
| α-helix | 23-29 | 7 | |
| α-helix | 30-34 | 5 | |
| α-helix | 42-56 | 15 | |
| α-helix | 62-81 | 20 | |
| β-strand | 94-97 | 4 | 1 |
| β-strand | 104-107 | 4 | 1 |
| α-helix | 110-131 | 22 | |
| α-helix | 137-160 | 24 | |
| α-helix | 167-169 | 3 | |
| α-helix | 171-195 | 25 | |
| α-helix | 200-221 | 22 | |
| α-helix | 224-230 | 7 | |
| α-helix | 232-262 | 31 | |
| α-helix | 266-286 | 21 | |
| α-helix | 292-315 | 24 | |
| α-helix | 316-320 | 5 | |
| α-helix | 327-329 | 3 | |
| α-helix | 331-335 | 5 | |
| α-helix | 341-343 | 3 | |
| α-helix | 349-352 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-20 | 18 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-8 | 5 | |
| α-helix | 13-16 | 4 | |
| β-strand | 17-20 | 4 | 2 |
| α-helix | 23-34 | 12 | |
| α-helix | 42-56 | 15 | |
| α-helix | 62-81 | 20 | |
| β-strand | 94-97 | 4 | 2 |
| β-strand | 104-107 | 4 | 2 |
| α-helix | 110-131 | 22 | |
| α-helix | 137-160 | 24 | |
| α-helix | 167-169 | 3 | |
| α-helix | 171-195 | 25 | |
| α-helix | 200-222 | 23 | |
| α-helix | 224-230 | 7 | |
| α-helix | 232-262 | 31 | |
| α-helix | 266-286 | 21 | |
| α-helix | 292-315 | 24 | |
| α-helix | 316-320 | 5 | |
| α-helix | 327-329 | 3 | |
| α-helix | 331-335 | 5 | |
| α-helix | 341-343 | 3 | |
| α-helix | 349-352 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-20 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tyrosine-protein phosphatase non-receptor type 23 | A, C | protein | 361 | Homo sapiens | Q9H3S7 (AlphaFold model) |
| Zinc finger FYVE domain-containing protein 16 | B, D | protein | 22 | Homo sapiens | Q7Z3T8 (AlphaFold model) |
>5MK0_1 Tyrosine-protein phosphatase non-receptor type 23 (chains A, C) MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPR DFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYN LGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNL MLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKL VQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRF TMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKL V
>5MK0_2 Zinc finger FYVE domain-containing protein 16 (chains B, D) MDSYFKAAVSDLDKLLDDFEQN
Structural Basis for Specific Interaction of TGF beta Signaling Regulators SARA/Endofin with HD-PTP. Gahloth, D., Levy, C., Walker, L. et al. Structure (2017) 25:1011-1024.e4. DOI 10.1016/j.str.2017.05.005 · PubMed
Other PDB entries of the same protein (UniProt Q9H3S7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5MK0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.