Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a triclinic closed form. Determined by X-ray diffraction at 1.8 Å resolution. Released 31 Aug 2011.
Explore 3T7M in 3D Show helices and sheets RCSB PDB PDBe
3T7M contains 36 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-10 | 7 | 1 |
| α-helix | 13-28 | 16 | |
| β-strand | 34-39 | 6 | 1 |
| α-helix | 45-54 | 10 | |
| β-strand | 57-60 | 4 | 1 |
| α-helix | 69-74 | 6 | |
| α-helix | 78-91 | 14 | |
| β-strand | 97-101 | 5 | 1 |
| β-strand | 105-107 | 3 | 2 |
| α-helix | 112-116 | 5 | |
| β-strand | 121-124 | 4 | 1 |
| α-helix | 125 | 1 | |
| β-strand | 132-139 | 8 | 1 |
| α-helix | 143-156 | 14 | |
| α-helix | 163-170 | 8 | |
| α-helix | 179-181 | 3 | |
| β-strand | 182 | 1 | 1 |
| α-helix | 185-187 | 3 | |
| β-strand | 189-190 | 2 | 2 |
| α-helix | 191-196 | 6 | |
| α-helix | 198-204 | 7 | |
| α-helix | 205-207 | 3 | |
| β-strand | 210-212 | 3 | 2 |
| α-helix | 219-221 | 3 | |
| β-strand | 223-225 | 3 | 3 |
| β-strand | 230-232 | 3 | 3 |
| α-helix | 238-241 | 4 | |
| α-helix | 244-252 | 9 | |
| α-helix | 253-257 | 5 | |
| α-helix | 258-261 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1-10 | 10 | 4 |
| α-helix | 13-28 | 16 | |
| β-strand | 33-39 | 7 | 4 |
| α-helix | 45-54 | 10 | |
| β-strand | 57-60 | 4 | 4 |
| α-helix | 69-74 | 6 | |
| α-helix | 80-91 | 12 | |
| β-strand | 97-101 | 5 | 4 |
| β-strand | 105-107 | 3 | 5 |
| α-helix | 112-116 | 5 | |
| β-strand | 121-124 | 4 | 4 |
| α-helix | 125 | 1 | |
| β-strand | 132-139 | 8 | 4 |
| α-helix | 143-156 | 14 | |
| α-helix | 163-170 | 8 | |
| α-helix | 179-181 | 3 | |
| β-strand | 182 | 1 | 4 |
| α-helix | 185-187 | 3 | |
| β-strand | 189-190 | 2 | 5 |
| α-helix | 191-196 | 6 | |
| α-helix | 198-204 | 7 | |
| α-helix | 205-207 | 3 | |
| β-strand | 210-212 | 3 | 5 |
| α-helix | 219-221 | 3 | |
| β-strand | 223-225 | 3 | 6 |
| β-strand | 230-232 | 3 | 6 |
| α-helix | 238-241 | 4 | |
| α-helix | 244-252 | 9 | |
| α-helix | 253-257 | 5 | |
| α-helix | 258-261 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glycogenin-1 | A, B | protein | 263 | Homo sapiens | P46976 (AlphaFold model) |
>3T7M_1 Glycogenin-1 (chains A, B) SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVI MVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREE LSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDI RKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPN MTHPEFLILWWNIFTTNVLPLLQ
Water and common crystallization additives (EDO) are not listed.
Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis. Chaikuad, A., Froese, D.S., Berridge, G. et al. Proc Natl Acad Sci U S A (2011) 108:21028-21033. DOI 10.1073/pnas.1113921108 · PubMed
Other PDB entries of the same protein (UniProt P46976 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3T7M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.