3T92: Taz2:C/EBPepsilon-TAD chimera protein

Crystal structure of the Taz2:C/EBPepsilon-TAD chimera protein. Determined by X-ray diffraction at 1.5 Å resolution. Released 8 Aug 2012.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,128
Mol. weight: 14.11 kDa
Ligands: ZN, TCE, TAM, ACN
Released: 8 Aug 2012

Explore 3T92 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3T92 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	8-25	18
α-helix	34-48	15
α-helix	58-71	14
α-helix	84-107	24
α-helix	110-117	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase P300 TAZ2-ccaat/enhancer-binding protein epsilon	A	protein	121	Homo sapiens	Q09472 (AlphaFold model), Q15744 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3T92_1 HISTONE ACETYLTRANSFERASE P300 TAZ2-CCAAT/ENHANCER-BINDING PROTEIN EPSILON (chains A)
ATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPIC
KQLIALAAYHAKHCQENKCPVPFCLNIKQKLRQQQLEASIDLSAYIESGEEQLLSDLFAV
K

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3
TCE	3,3',3''-phosphanetriyltripropanoic acid	C9 H15 O6 P	1
TAM	Tris(hydroxyethyl)aminomethane	C7 H17 N O3	1
ACN	Acetone	C3 H6 O	1

Primary citation

Structural insights into interactions of C/EBP transcriptional activators with the Taz2 domain of p300. Bhaumik, P., Davis, J., Tropea, J.E. et al. Acta Crystallogr D Biol Crystallogr (2014) 70:1914-1921. DOI 10.1107/S1399004714009262 · PubMed

Other PDB entries of the same protein (UniProt Q09472 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BT3 1.05 Å, Crystal structure of EP300 bromodomain in complex with SGC-CBP30 chemical probe
5LPM 1.5 Å, Crystal structure of the bromodomain of human Ep300 bound to the inhibitor XDM3d
5NU5 1.6 Å, Crystal structure of the human bromodomain of EP300 bound to the inhibitor XDM-CBP
3BIY 1.7 Å, Crystal structure of p300 histone acetyltransferase domain in complex with a bisubstrate…
6PGU 1.72 Å, Crystal structure of the p300 acetyltransferase domain with allosteric inhibitor CPI-076…
6V8K 1.84 Å, Crystal structure of the p300 acetyltransferase domain with peptide-competitive…
4PZS 1.94 Å, Crystal structure of p300 histone acetyltransferase domain in complex with…
5KJ2 1.95 Å, The novel p300/CBP inhibitor A-485 uncovers a unique mechanism of action to target AR in…
6DS6 1.95 Å, Crystal structure of p300 ZZ domain in complex with histone H3 peptide
7QGS 2.0 Å, Crystal structure of p300 CH1 domain in complex with CITIF (a CITED2-HIF-1alpha hybrid)
7UGI 2.0 Å, Bromodomain of EP300 liganded with BMS-536924
7VHZ 2.0 Å, Crystal structure of EP300 HAT domain in complex with compound 7

Browse structure collections

About this viewer

MolViewer shows 3T92 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.