3TJH: 42F3-p3A1/H2-Ld complex

42F3-p3A1/H2-Ld complex. Determined by X-ray diffraction at 2.12 Å resolution. Released 7 Dec 2011.

Method: X-ray diffraction
Resolution: 2.12 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 5,369
Mol. weight: 75.54 kDa
Released: 7 Dec 2011

Explore 3TJH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TJH contains 20 α-helices and 52 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	1
α-helix	18-20	3
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	50-52	3
α-helix	57-84	28
β-strand	94-103	10	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-150	13
α-helix	152-161	10
α-helix	163-172	10

Chain C: 6 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	1-4	4	2
β-strand	9-13	5	3
β-strand	18-20	3	2
β-strand	23-26	4	2
β-strand	30-37	8	3
β-strand	44-49	6	3
β-strand	55-57	3	2
α-helix	59-61	3
β-strand	62-67	6	2
β-strand	72-77	6	2
α-helix	82-84	3
β-strand	86-94	9	3
β-strand	101-103	3	3
β-strand	107-112	6	3
α-helix	113-114	2
β-strand	121-127	7	4
β-strand	134-139	6	4
α-helix	147-150	4
β-strand	155-157	3	4
α-helix	158-160	3
β-strand	161-165	5	4
β-strand	170-179	10	4
α-helix	186-189	4
β-strand	200	1	4

Chain D: 8 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	5
β-strand	10-14	5	6
β-strand	19-21	3	7
β-strand	22-25	4	5
β-strand	31-38	8	6
β-strand	42-49	8	6
β-strand	56-57	2	6
β-strand	64-67	4	7
β-strand	73	1	5
β-strand	75-78	4	7
α-helix	83-85	3
β-strand	87-96	10	6
β-strand	99-102	4	6
β-strand	106-111	6	6
α-helix	114-116	3
β-strand	118	1	8
α-helix	119-120	2
β-strand	121-126	6	4
α-helix	127-128	2
α-helix	129-135	7
β-strand	137-147	11	4
β-strand	148	1	8
β-strand	152-158	7	9
β-strand	161-163	3	9
β-strand	167-169	3	4
α-helix	173	1
β-strand	174-175	2	4
β-strand	185-194	10	4
α-helix	195-198	4
β-strand	204-211	8	9
β-strand	214	1	10
α-helix	225-226	2
β-strand	228	1	10
β-strand	230-237	8	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H2-Ld SBM2	A	protein	180	Mus musculus	P01897 (AlphaFold model)
p3A1	B	protein	9
42F3 alpha	C	protein	226	Mus musculus, Homo sapiens
42F3 beta	D	protein	254	Mus musculus, Homo sapiens

Sequence of entity 1 (A), FASTA

>3TJH_1 H2-Ld SBM2 (chains A)
MGPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEY
WERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYD
GCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNGNATL

Sequence of entity 2 (B), FASTA

>3TJH_2 p3A1 (chains B)
SPLDSLWWI

Sequence of entity 3 (C), FASTA

>3TJH_3 42F3 alpha (chains C)
ADPGYLLEAQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQMLLKYYS
GDPVVQGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAVSAKGTGSKLSFGKGAKLTV
SPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFK
SNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSSRGGLEVLFQ

Sequence of entity 4 (D), FASTA

>3TJH_4 42F3 beta (chains D)
ADPEAAVTQSPRNKVTVTGGNVTLSCRQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLQI
GDVPDGYKATRTTQEDFFLLLELASPSQTSLYFCASSDAPGQLYFGEGSKLTVLEDLKNV
FPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQ
PALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAW
GRADSRGGLEVLFQ

Primary citation

T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex. Adams, J.J., Narayanan, S., Liu, B. et al. Immunity (2011) 35:681-693. DOI 10.1016/j.immuni.2011.09.013 · PubMed

Other PDB entries of the same protein (UniProt P01897 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V4U 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UO1 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3V52 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UYR 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
6L9K 1.8 Å, H2-Ld a1a2 complexed with A5 peptide
8D5N 1.8 Å, Crystal structure of Ld-HF10
3VJ6 1.9 Å, Structure of the MHC class Ib molecule Qa-1b
4MS8 1.92 Å, 42F3 TCR pCPB9/H-2Ld Complex
3ERY 1.95 Å, Different thermodynamic binding mechanisms and peptide fine specificities associated…
5VCL 2.05 Å, Structure of the Qdm peptide bound to Qa-1a
2OI9 2.35 Å, Structure of the 2C/Ld/QL9 allogeneic complex
6L9L 2.4 Å, 1D4 TCR recognition of H2-Ld a1a2 A5 Peptide Complexes

Browse structure collections

About this viewer

MolViewer shows 3TJH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.