Crystal Structure of Quasiracemic Villin Headpiece Subdomain Containing (F5Phe10) Substitution. Determined by X-ray diffraction at 1.46 Å resolution. Released 25 Jan 2012.
Explore 3TJW in 3D Show helices and sheets RCSB PDB PDBe
3TJW contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-10 | 8 | |
| α-helix | 14-18 | 5 | |
| α-helix | 22-32 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| D-Villin-1 | A | protein | 34 | Gallus gallus | P02640 (AlphaFold model) |
| L-Villin-1 | B | protein | 34 | Gallus gallus | P02640 (AlphaFold model) |
>3TJW_1 D-Villin-1 (chains A) LSDEDFKAVFGMTRSAFANLPLWKQQHLKKEKGL
>3TJW_2 L-Villin-1 (chains B) LSDEDFKAVFGMTRSAFANLPLWKQQHLKKEKGL
Quasiracemic crystallization as a tool to assess the accommodation of noncanonical residues in nativelike protein conformations. Mortenson, D.E., Satyshur, K.A., Guzei, I.A. et al. J Am Chem Soc (2012) 134:2473-2476. DOI 10.1021/ja210045s · PubMed
Other PDB entries of the same protein (UniProt P02640 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3TJW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.