3TNU: Keratin, type I cytoskeletal 14

Heterocomplex of coil 2B domains of human intermediate filament proteins, keratin 5 (KRT5) and keratin 14 (KRT14). Determined by X-ray diffraction at 3.0 Å resolution. Released 20 Jun 2012.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,510
Mol. weight: 30.4 kDa
Released: 20 Jun 2012

Explore 3TNU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TNU contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	333-418	86

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	383-472	90

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Keratin, type I cytoskeletal 14	A	protein	131	Homo sapiens	P02533 (AlphaFold model)
Keratin, type II cytoskeletal 5	B	protein	129	Homo sapiens	P13647 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3TNU_1 Keratin, type I cytoskeletal 14 (chains A)
GSTAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSM
KASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQE
IATYRRLLEGE

Sequence of entity 2 (B), FASTA

>3TNU_2 Keratin, type II cytoskeletal 5 (chains B)
MANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCA
NLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIA
TYRKLLEGE

Primary citation

Structural basis for heteromeric assembly and perinuclear organization of keratin filaments. Lee, C.H., Kim, M.S., Chung, B.M. et al. Nat Struct Mol Biol (2012) 19:707-715. DOI 10.1038/nsmb.2330 · PubMed

Other PDB entries of the same protein (UniProt P02533 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JFV 2.6 Å, The crystal structure of 2B-2B complex from keratins 5 and 14 (C367A mutant of K14)
9VHF Keratin 14 120 - 144 peptide fragment (R125G)
9VHO Keratin 14 120 - 144 peptide fragment (R125H)
9VHS Keratin 14 120 - 144 peptide fragment
9VHX Keratin 14 120 - 144 peptide fragment (R125S)

Browse more

3TNU is part of these collections:

Motor proteins and the cytoskeleton

About this viewer

MolViewer shows 3TNU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.