3TVJ: Catalytic fragment of MASP-2

Catalytic fragment of MASP-2 in complex with its specific inhibitor developed by directed evolution on SGCI scaffold. Determined by X-ray diffraction at 1.28 Å resolution. Released 25 Apr 2012.

Method: X-ray diffraction
Resolution: 1.28 Å
Organisms: Homo sapiens, Schistocerca gregaria
Chains: 3
Atoms: 3,450
Mol. weight: 39.88 kDa
Released: 25 Apr 2012

Explore 3TVJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TVJ contains 18 α-helices and 32 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	365	1	1
α-helix	369-371	3
β-strand	375-379	5	2
β-strand	387	1	1
β-strand	391-396	6	2
α-helix	397	1
β-strand	401-404	4	3
β-strand	409-412	4	2
β-strand	418-420	3	2
α-helix	427-428	2
β-strand	429-432	4	3
α-helix	433-434	2

Chain B: 14 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	446	1	4
β-strand	449-450	2	5
α-helix	451-452	2
β-strand	459-463	5	6
β-strand	466-472	7	6
β-strand	477-480	4	6
α-helix	482-485	4
α-helix	486-490	5
α-helix	494-495	2
β-strand	496-499	4	6
β-strand	503	1	7
α-helix	509	1
β-strand	510-519	10	6
β-strand	534-538	5	6
α-helix	541-544	4
β-strand	545	1	8
β-strand	548	1	8
α-helix	550-551	2
β-strand	552	1	5
α-helix	553-554	2
α-helix	558-561	4
β-strand	567-572	6	5
β-strand	584	1	7
β-strand	586-592	7	5
α-helix	593-594	2
α-helix	595-603	9
α-helix	608	1
β-strand	616-619	4	5
β-strand	627	1	4
β-strand	636-641	6	5
β-strand	646-657	12	5
β-strand	667-671	5	5
α-helix	672-675	4
α-helix	676-685	10

Chain I: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	5
β-strand	15-19	5	5
β-strand	26-29	4	5
β-strand	32-33	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mannan-binding lectin serine protease 2 A chain	A	protein	86	Homo sapiens	O00187 (AlphaFold model)
Mannan-binding lectin serine protease 2 B chain	B	protein	242	Homo sapiens	O00187 (AlphaFold model)
Protease inhibitor SGPI-2	I	protein	38	Schistocerca gregaria	O46162 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3TVJ_1 Mannan-binding lectin serine protease 2 A chain (chains A)
ASMTIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCDADGFW
TSSKGEKSLPVCEPVCGLSARTTGGR

Sequence of entity 2 (B), FASTA

>3TVJ_2 Mannan-binding lectin serine protease 2 B chain (chains B)
IYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKR
LSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRT
DDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESG
GKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIIS
DF

Sequence of entity 3 (I), FASTA

>3TVJ_3 Protease inhibitor SGPI-2 (chains I)
GSGEVTCEPGTTFKDKCNTCRCGSDGKSAVCTKLWCNQ

Primary citation

Monospecific Inhibitors Show That Both Mannan-binding Lectin-associated Serine Protease-1 (MASP-1) and -2 Are Essential for Lectin Pathway Activation and Reveal Structural Plasticity of MASP-2. Heja, D., Harmat, V., Fodor, K. et al. J Biol Chem (2012) 287:20290-20300. DOI 10.1074/jbc.M112.354332 · PubMed

Other PDB entries of the same protein (UniProt O00187 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9D40 1.76 Å, Crystal structure of the catalytic region of human MASP-2 with specific inhibitor Analog…
9D17 1.97 Å, Crystal structure of the catalytic region of human MASP-2 with specific inhibitor…
9D3Y 2.08 Å, Crystal structure of the catalytic region of human MASP-2 with specific inhibitor…
1ZJK 2.18 Å, Crystal structure of the zymogen catalytic region of human MASP-2
1Q3X 2.23 Å, Crystal structure of the catalytic region of human MASP-2
9D4D 2.36 Å, Crystal structure of the catalytic region of human MASP-2 with specific inhibitor…
7PQN 2.4 Å, Catalytic fragment of MASP-2 in complex with ecotin
1SZB 2.5 Å, Crystal structure of the human MBL-associated protein 19 (MAp19)
5JPM 3.75 Å, Structure of the complex of human complement C4 with MASP-2 rebuilt using iMDFF

Browse structure collections

About this viewer

MolViewer shows 3TVJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.