3TWR: ARC4 from human Tankyrase 2
Crystal structure of ARC4 from human Tankyrase 2 in complex with peptide from human 3BP2. Determined by X-ray diffraction at 1.55 Å resolution. Released 7 Dec 2011.
- Method
- X-ray diffraction
- Resolution
- 1.55 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 6,150
- Mol. weight
- 80.31 kDa
- Ligands
- PE8
- Released
- 7 Dec 2011
Explore 3TWR in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3TWR contains 44 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 10 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 491-502 | 12 | |
| α-helix | 505-511 | 7 | |
| α-helix | 529-535 | 7 | |
| α-helix | 539-547 | 9 | |
| α-helix | 562-568 | 7 | |
| α-helix | 572-580 | 9 | |
| α-helix | 595-601 | 7 | |
| α-helix | 605-613 | 9 | |
| α-helix | 629-631 | 3 | |
| α-helix | 637-644 | 8 | |
Chain B: 10 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 491-502 | 12 | |
| α-helix | 505-511 | 7 | |
| α-helix | 529-535 | 7 | |
| α-helix | 539-547 | 9 | |
| α-helix | 562-568 | 7 | |
| α-helix | 572-580 | 9 | |
| α-helix | 595-601 | 7 | |
| α-helix | 605-613 | 9 | |
| α-helix | 628-631 | 4 | |
| α-helix | 637-643 | 7 | |
Chain C: 10 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 491-502 | 12 | |
| α-helix | 505-511 | 7 | |
| α-helix | 529-535 | 7 | |
| α-helix | 539-547 | 9 | |
| α-helix | 562-568 | 7 | |
| α-helix | 572-580 | 9 | |
| α-helix | 595-601 | 7 | |
| α-helix | 605-613 | 9 | |
| α-helix | 628-631 | 4 | |
| α-helix | 637-644 | 8 | |
Chain D: 10 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 491-502 | 12 | |
| α-helix | 505-511 | 7 | |
| α-helix | 529-535 | 7 | |
| α-helix | 539-547 | 9 | |
| α-helix | 562-568 | 7 | |
| α-helix | 572-580 | 9 | |
| α-helix | 595-601 | 7 | |
| α-helix | 605-613 | 9 | |
| α-helix | 629-631 | 3 | |
| α-helix | 637-643 | 7 | |
Chains E and F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-9 | 3 | |
Chains G and H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-9 | 2 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Tankyrase-2 | A, B, C, D | protein | 165 | Homo sapiens | Q9H2K2 (AlphaFold model) |
| SH3 domain-binding protein 2 | E, F, G, H | protein | 16 | Homo sapiens | P78314 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>3TWR_1 Tankyrase-2 (chains A, B, C, D)
GAMGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEY
LLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGK
YEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAAL
Sequence of entity 2 (E, F, G, H), FASTA
>3TWR_2 SH3 domain-binding protein 2 (chains E, F, G, H)
LPHLQRSPPDGQSFRS
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| PE8 | 3,6,9,12,15,18,21-heptaoxatricosane-1,23-diol | C16 H34 O9 | 2 |
Water and common crystallization additives (SO4) are not listed.
Primary citation
Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease. Guettler, S., Larose, J., Petsalaki, E. et al. Cell (2011) 147:1340-1354. DOI 10.1016/j.cell.2011.10.046 · PubMed
Other PDB entries of the same protein (UniProt Q9H2K2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5BXO 1.33 Å, Human Tankyrase-2 in Complex with Macrocyclised Extended Peptide cp4n2m3
- 5BXU 1.35 Å, Human Tankyrase-2 in Complex with Macrocyclised Extended Peptide cp4n4m5
- 5NWG 1.4 Å, Crystal structure of TNKS2 in complex with 7-chloro-2-{4-[(2-hydroxyethyl)(methyl)amino]p…
- 5NWD 1.45 Å, Crystal structure of TNKS2 in complex with 2-[4-(diethylamino)phenyl]-3,4-dihydroquinazol…
- 4PNL 1.5 Å, Crystal structure of TNKS-2 in complex with DR2313.
- 5NVE 1.5 Å, Crystal structure of TNKS2 in complex with 2-(4-ethoxyphenyl)-3,4-dihydroquinazolin-4-one
- 5NWC 1.5 Å, Crystal structure of TNKS2 in complex with 2-(2-aminophenyl)-3,4-dihydroquinazolin-4-one
- 7CE4 1.5 Å, Tankyrase2 catalytic domain in complex with K-476
- 5JRT 1.53 Å, Crystal structure of the human Tankyrase 2 (TNKS2) SAM domain (DH902/924RE)
- 5C5R 1.55 Å, Crystal structure of human tankyrase-2 in complex with a pyranopyridone inhibitor
- 5NVF 1.55 Å, Crystal structure of TNKS2 in complex with 2-[4-(pyridin-2-yl)phenyl]-3,4-dihydroquinazol…
- 4TJU 1.57 Å, Crystal Structure of human Tankyrase 2 in complex with 3,4-CPQ-5-C.
Browse structure collections
About this viewer
MolViewer shows 3TWR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.