3U06: Kinesin-14 NcdG347D

Crystal structure of the kinesin-14 NcdG347D. Determined by X-ray diffraction at 2.35 Å resolution. Released 7 Mar 2012.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 5,836
Mol. weight: 94.92 kDa
Ligands: ADP, MG
Released: 7 Mar 2012

Explore 3U06 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3U06 contains 33 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	293-345	53
β-strand	349-355	7	1
α-helix	356-359	4
α-helix	360-362	3
β-strand	367	1	2
β-strand	369-374	6	3
β-strand	377-381	5	3
β-strand	395-397	3	3
β-strand	400-402	3	1
α-helix	408-412	5
α-helix	416-423	8
β-strand	428-433	6	1
α-helix	440-444	5
β-strand	446-447	2	4
β-strand	450-451	2	4
α-helix	453-468	16
α-helix	469-471	3
β-strand	473-485	13	1
β-strand	488-491	4	1
β-strand	502-504	3	5
β-strand	512-514	3	5
β-strand	520-521	2	1
α-helix	525-538	14
α-helix	547-550	4
β-strand	554-565	12	1
β-strand	570-580	11	1
α-helix	581-583	3
α-helix	601-614	14
α-helix	622-624	3
α-helix	626-631	6
α-helix	632-634	3
β-strand	640-647	8	1
β-strand	650	1	2
α-helix	651-653	3
α-helix	654-670	17

Chain B: 16 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	291-346	56
α-helix	348-349	2
β-strand	350-355	6	6
α-helix	356-359	4
α-helix	361-364	4
β-strand	367	1	7
β-strand	369-374	6	8
β-strand	377-381	5	8
α-helix	389-391	3
β-strand	395-397	3	8
β-strand	400-402	3	6
α-helix	408-413	6
α-helix	416-422	7
β-strand	427-433	7	6
α-helix	440-444	5
β-strand	446-447	2	9
β-strand	450-451	2	9
α-helix	453-471	19
β-strand	474-485	12	6
β-strand	488-491	4	6
β-strand	520-521	2	6
α-helix	525-537	13
β-strand	554-564	11	6
β-strand	571-580	10	6
α-helix	581-583	3
α-helix	601-615	15
α-helix	622-624	3
α-helix	626-631	6
β-strand	641-647	7	6
β-strand	650	1	7
α-helix	651-653	3
α-helix	654-667	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein claret segregational	A, B	protein	412	Drosophila melanogaster	P20480 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3U06_1 Protein claret segregational (chains A, B)
MGSMHAALSTEVVHLRQRTEELLRCNEQQAAELETCKEQLFQSNMERKELHNTVMDLRDN
IRVFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQ
SDIFEMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESVGVIPRTVDLLFDSIRGY
RNLGWEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHL
RHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSESPK
TSTRMTETKNINRSLSELTNVILALLQKQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVS
PFQDCFQESVKSLRFAASVNSCKMTKAKRNRYLNNSVANSSTQSNNSGSFDK

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
MG	Magnesium ion	Mg	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Neck-motor interactions trigger rotation of the kinesin stalk. Liu, H.L., Pemble Iv, C.W., Endow, S.A. Sci Rep (2012) 2:236-236. DOI 10.1038/srep00236 · PubMed

Other PDB entries of the same protein (UniProt P20480 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1N6M 2.5 Å, Rotation of the stalk/neck and one head in a new crystal structure of the kinesin motor…
2NCD 2.5 Å, Ncd (non-claret disjunctional) dimer from D. Melanogaster
3L1C 2.75 Å, Kinesin-14 Protein Ncd, T436S Mutant
5W3D 2.79 Å, The structure of kinesin-14 wild-type Ncd-ADP dimer
1CZ7 2.9 Å, The crystal structure of a minus-end directed microtubule motor protein ncd reveals…
5HLE 2.9 Å, Structural basis of backwards motion in kinesin-14: minus-end directed nKn664 in the ADP…
8YUE 3.15 Å, Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster
8YY3 3.24 Å, Kinesin-14 in nucleotide-free state bound to 14 PF Microtubule
8YY2 3.6 Å, Kinesin-14 in nucleotide-free state bound to 13 PF Microtubule
8YY5 3.99 Å, Kinesin-14 with AlF3 bound to 14 PF Microtubule
8YY4 4.02 Å, Kinesin-14 with AlF3 bound to 13 PF Microtubule
5HNZ 5.8 Å, Structural basis of backwards motion in kinesin-14: plus-end directed nKn669 in the…

Browse structure collections

About this viewer

MolViewer shows 3U06 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.