3U3F: Protein-tyrosine kinase 2-beta

Structural basis for the interaction of Pyk2 PAT domain with paxillin LD motifs. Determined by X-ray diffraction at 3.1 Å resolution. Released 24 Oct 2012.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 10
Atoms: 4,292
Mol. weight: 72.53 kDa
Released: 24 Oct 2012

Explore 3U3F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3U3F contains 26 α-helices and 0 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	879-895	17
α-helix	903-905	3
α-helix	906-927	22
α-helix	933-962	30
α-helix	969-1004	36

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	879-897	19
α-helix	903-905	3
α-helix	906-925	20
α-helix	928-930	3
α-helix	933-962	30
α-helix	969-1004	36

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	879-897	19
α-helix	903-925	23
α-helix	928-930	3
α-helix	933-962	30
α-helix	969-1001	33

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	879-897	19
α-helix	903-927	25
α-helix	933-962	30
α-helix	969-1001	33

Chains E, F and G: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	263-272	10

Chain H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	263-273	11

Chain I: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	267-273	7

Chain J: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	267-274	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein-tyrosine kinase 2-beta	A, B, C, D	protein	139	Homo sapiens	Q14289 (AlphaFold model)
Paxillin LD2 peptide	E, F, G, H, I, J	protein	17	Homo sapiens	P49023 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3U3F_1 Protein-tyrosine kinase 2-beta (chains A, B, C, D)
GSHMANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDD
LLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVD
AKNLLDAVDQAKVLANLAH

Sequence of entity 2 (E, F, G, H, I, J), FASTA

>3U3F_2 Paxillin LD2 peptide (chains E, F, G, H, I, J)
SATRELDELMASLSDFK

Primary citation

Structural and Mechanistic Insights into the Interaction between Pyk2 and Paxillin LD Motifs. Vanarotti, M.S., Miller, D.J., Guibao, C.D. et al. J Mol Biol (2014) 426:3985-4001. DOI 10.1016/j.jmb.2014.08.014 · PubMed

Other PDB entries of the same protein (UniProt Q14289 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CC6 1.6 Å, Crystal structure of kinase domain of protein tyrosine kinase 2 beta (PTK2B)
3FZS 1.75 Å, Crystal Structure of PYK2 complexed with BIRB796
4XEK 1.79 Å, Pyk2-FAT domain in complex with leupaxin LD4 motif
8XOX 1.9 Å, The Crystal Structure of FAK2 from Biortus.
3FZT 1.95 Å, Crystal structure of PYK2 complexed with PF-4618433
5TO8 1.98 Å, Selectivity switch between FAK and Pyk2: Macrocyclization of FAK inhibitors improves…
4H1M 1.99 Å, Crystal structure of PYK2 with the indole 10c
3H3C 2.0 Å, Crystal structure of PYK2 in complex with Sulfoximine-substituted…
4H1J 2.0 Å, Crystal structure of PYK2 with the pyrazole 13a
8YGX 2.0 Å, Structure of the PYK2 from Biortus.
4XEV 2.01 Å, Fusion of Pyk2-FAT domain with Leupaxin LD1 motif, complexed with Leupaxin LD4 peptide
3FZP 2.1 Å, Crystal structure of PYK2 complexed with ATPgS

Browse structure collections

About this viewer

MolViewer shows 3U3F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.