3U74: Stabilized human uPAR mutant

Crystal structure of stabilized human uPAR mutant. Determined by X-ray diffraction at 2.39 Å resolution. Released 18 Apr 2012.

Method: X-ray diffraction
Resolution: 2.39 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,081
Mol. weight: 32.1 kDa
Ligands: NAG
Released: 18 Apr 2012

Explore 3U74 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3U74 contains 9 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain U: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
β-strand	12-16	5	1
α-helix	17-18	2
β-strand	23-33	11	1
β-strand	36-46	11	1
β-strand	53-59	7	1
β-strand	62-71	10	1
β-strand	94-97	4	2
β-strand	98	1	1
α-helix	104-107	4
β-strand	111-114	4	2
β-strand	121-128	8	1
β-strand	142-149	8	1
β-strand	155-160	6	1
β-strand	165-171	7	1
α-helix	181-182	2
α-helix	184-186	3
α-helix	188	1
β-strand	189-196	8	3
β-strand	197-199	3	1
β-strand	200	1	4
β-strand	204	1	4
α-helix	207-209	3
β-strand	211-216	6	3
β-strand	221-229	9	1
β-strand	235-242	8	1
α-helix	244-246	3
α-helix	249-256	8
β-strand	258-266	9	1
α-helix	274-276	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Urokinase plasminogen activator surface receptor	U	protein	283	Homo sapiens	Q03405 (AlphaFold model)

Sequence of entity 1 (U), FASTA

>3U74_1 Urokinase plasminogen activator surface receptor (chains U)
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTCSEKTNRTLSYRTG
LKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEE
QCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGP
ILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRG
CATASMCQHAHLGDAFSMCHIDVSCCTKSGCNHPDLDVQYRSG

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Crystal structure of the urokinase receptor in a ligand-free form. Xu, X., Gardsvoll, H., Yuan, C. et al. J Mol Biol (2012) 416:629-641. DOI 10.1016/j.jmb.2011.12.058 · PubMed

Other PDB entries of the same protein (UniProt Q03405 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FD6 1.9 Å, Structure of Human Urokinase Plasminogen Activator in Complex with Urokinase Receptor…
3BT2 2.5 Å, Structure of urokinase receptor, urokinase and vitronectin complex
1YWH 2.7 Å, crystal structure of urokinase plasminogen activator receptor
2I9B 2.8 Å, Crystal structure of ATF-urokinase receptor complex
3BT1 2.8 Å, Structure of urokinase receptor, urokinase and vitronectin complex
7V63 2.91 Å, Structure of dimeric uPAR at low pH
9YC5 2.94 Å, Human uPAR bound to the Fab fragment of targeted cancer therapeutic antibody FL1
7E17 2.96 Å, Structure of dimeric uPAR
4QTI 3.0 Å, Crystal structure of human uPAR in complex with anti-uPAR Fab 8B12
3U73 3.19 Å, Crystal structure of stabilized human uPAR mutant in complex with ATF
4K24 4.5 Å, Structure of anti-uPAR Fab ATN-658 in complex with uPAR
9YC6 4.8 Å, Mutant human uPAR bound to the Fab fragment of the targeted cancer therapeutic antibody…

Browse structure collections

About this viewer

MolViewer shows 3U74 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.