3U7D: KRIT1/CCM1 FERM domain

Crystal structure of the KRIT1/CCM1 FERM domain in complex with the heart of glass (HEG1) cytoplasmic tail. Determined by X-ray diffraction at 2.49 Å resolution. Released 12 Sept 2012.

Method: X-ray diffraction
Resolution: 2.49 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,136
Mol. weight: 81.09 kDa
Released: 12 Sept 2012

Explore 3U7D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3U7D contains 31 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	421-425	5	1
β-strand	431-435	5	1
α-helix	439-441	3
α-helix	444-450	7
α-helix	457-459	3
β-strand	461-467	7	1
β-strand	470-473	4	1
α-helix	474-475	2
α-helix	480-485	6
α-helix	487-494	8
β-strand	505-510	6	1
α-helix	516-519	4
α-helix	525-541	17
α-helix	548-563	16
α-helix	581-583	3
α-helix	594-597	4
α-helix	598-610	13
α-helix	618-629	12
α-helix	637	1
β-strand	638-645	8	2
β-strand	655-663	9	2
β-strand	666-671	6	2
β-strand	677-682	6	2
β-strand	686-690	5	2
β-strand	696-701	6	2
β-strand	707-711	5	2
α-helix	715-727	13

Chain C: 16 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	421-425	5	3
β-strand	431-435	5	3
α-helix	439-441	3
α-helix	444-450	7
β-strand	461-467	7	3
β-strand	470-473	4	3
α-helix	474-475	2
α-helix	480-485	6
α-helix	487-494	8
α-helix	499-501	3
β-strand	505-510	6	3
α-helix	516-519	4
α-helix	525-540	16
α-helix	548-563	16
α-helix	568-571	4
α-helix	578-581	4
α-helix	594-597	4
α-helix	598-609	12
α-helix	618-629	12
α-helix	637	1
β-strand	638-644	7	4
β-strand	656-662	7	4
β-strand	666-671	6	4
β-strand	677-682	6	4
β-strand	686-690	5	4
β-strand	696-701	6	4
β-strand	707-711	5	4
α-helix	715-726	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Krev interaction trapped protein 1	A, C	protein	322	Homo sapiens	O00522 (AlphaFold model)
Protein HEG homolog 1	B, D	protein	26	Homo sapiens	Q9ULI3 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>3U7D_1 Krev interaction trapped protein 1 (chains A, C)
GAKPYEKVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQL
KPYHKPLQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDE
ARYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKA
PHWTNRILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHK
VIPVYVGVNIKGLHLLNMETKALLISLKYGCFMWQLGDTDTCFQIHSMENKMSFIVHTKQ
AGLVVKLLMKLNGQLMPTERNS

Sequence of entity 2 (B, D), FASTA

>3U7D_2 Protein HEG homolog 1 (chains B, D)
SRHSCIFPGQYNPSFISDESRRRDYF

Primary citation

Structural basis of the junctional anchorage of the cerebral cavernous malformations complex. Gingras, A.R., Liu, J.J., Ginsberg, M.H. J Cell Biol (2012) 199:39-48. DOI 10.1083/jcb.201205109 · PubMed

Other PDB entries of the same protein (UniProt O00522 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HDO 1.67 Å, Crystal structure of the binary Complex of KRIT1 bound to the Rap1 GTPase
4JIF 1.7 Å, Co-crystal structure of ICAP1 PTB domain in complex with a KRIT1 peptide
6OQ4 1.75 Å, Crystal Structure of the Ternary Complex of KRIT1 bound to both the Rap1 GTPase and HKi1
6OQ3 1.85 Å, Crystal Structure of the Ternary Complex of KRIT1 bound to both the Rap1 GTPase and HKi2
6UZK 1.92 Å, Crystal Structure of the Ternary Complex of KRIT1 bound to both the Rap1 GTPase and HKi6
4DXA 1.95 Å, Co-crystal structure of Rap1 in complex with KRIT1
4HDQ 1.95 Å, Crystal Structure of the Ternary Complex of KRIT1 bound to both the Rap1 GTPase and the…
8SU8 2.01 Å, Co-crystal structure of KRIT1 with a 1-hydroxy 2-naphthaldehyde derivative…
8T09 2.15 Å, Co-crystal structure of KRIT1 with a 1-hydroxy 2-naphthaldehyde derivative…
8T7V 2.25 Å, Co-crystal structure of KRIT1 with a 1-hydroxy 2-naphthaldehyde derivative…
4DX8 2.54 Å, ICAP1 in complex with KRIT1 N-terminus
5D68 2.91 Å, Crystal structure of KRIT1 ARD-FERM

Browse structure collections

About this viewer

MolViewer shows 3U7D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.