3U9Q: Ligand binding domain of PPARgamma

Ligand binding domain of PPARgamma complexed with Decanoic Acid and PGC-1a peptide. Determined by X-ray diffraction at 1.52 Å resolution. Released 9 Nov 2011.

Method: X-ray diffraction
Resolution: 1.52 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,529
Mol. weight: 31.88 kDa
Ligands: DKA
Released: 9 Nov 2011

Explore 3U9Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3U9Q contains 16 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	209-225	17
α-helix	230-237	8
α-helix	245-246	2
β-strand	247-249	3	1
α-helix	252-258	7
α-helix	277-301	25
α-helix	306-308	3
α-helix	311-332	22
β-strand	334-335	2	1
β-strand	338-341	4	1
β-strand	346-349	4	1
α-helix	350-355	6
α-helix	357	1
α-helix	360-362	3
α-helix	365-375	11
α-helix	381-392	12
α-helix	403-424	22
α-helix	431-458	28
α-helix	467-473	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	143-149	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peroxisome proliferator-activated receptor gamma	A	protein	269	Homo sapiens	P37231 (AlphaFold model)
PGC-1a peptide	B	protein	9	Homo sapiens	Q9UBK2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3U9Q_1 Peroxisome proliferator-activated receptor gamma (chains A)
SADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHI
TPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIY
TMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIF
IAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVT
EHVQLLQVIKKTETDMSLHPLLQEIYKDL

Sequence of entity 2 (B), FASTA

>3U9Q_2 PGC-1a peptide (chains B)
SLLKKLLLA

Ligands and cofactors

ID	Name	Formula	Copies
DKA	Decanoic acid	C10 H20 O2	1

Primary citation

Identification and Mechanism of 10-Carbon Fatty Acid as Modulating Ligand of Peroxisome Proliferator-activated Receptors. Malapaka, R.R., Khoo, S., Zhang, J. et al. J Biol Chem (2012) 287:183-195. DOI 10.1074/jbc.M111.294785 · PubMed

Other PDB entries of the same protein (UniProt P37231 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9F7W 1.25 Å, Human PPARgamma ligand binding domain in complex with co-activator 1alpha peptide and…
8BF1 1.36 Å, High-resolution structure of unliganded PPAR gamma in complex with the peptide PGC-1 alpha
9V8G 1.39 Å, PPARgamma ligand-binding domain in complex with PG08-NL
9V8H 1.39 Å, PPARgamma ligand-binding domain in complex with PG08-NL and rosiglitazone
8FKC 1.42 Å, Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and…
6MS7 1.43 Å, Peroxisome proliferator-activated receptor gamma ligand binding domain in complex with a…
9V8D 1.44 Å, PPARgamma ligand-binding domain in complex with PG08
8B94 1.55 Å, Crystal structure of PPARG and NCOR2 with BAY-5516, an inverse agonist
8DKV 1.59 Å, PPARg bound to JTP-426467 and Co-R peptide
3B1M 1.6 Å, Crystal structure of the PPARgamma-LBD complexed with a cercosporamide derivative…
3V9V 1.6 Å, Crystal structure of the PPARgamma-LBD complexed with a cercosporamide derivative…
9F7X 1.63 Å, Human PPARgamma ligand binding domain in complex with co-activator 1alpha peptide and…

Browse structure collections

About this viewer

MolViewer shows 3U9Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.