3UQS: Murine norovirus RNA-dependent RNA polymerase

Crystal structures of murine norovirus RNA-dependent RNA polymerase. Determined by X-ray diffraction at 2.0 Å resolution. Released 2 May 2012.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: murine norovirus
Chains: 3
Atoms: 12,943
Mol. weight: 176.56 kDa
Released: 2 May 2012

Explore 3UQS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UQS contains 88 α-helices and 74 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
β-strand	8-9	2	1
β-strand	12-13	2	1
β-strand	14-17	4	2
α-helix	20-24	5
β-strand	27-31	5	3
α-helix	36-38	3
β-strand	43-44	2	4
α-helix	45-46	2
α-helix	59-67	9
α-helix	68-71	4
α-helix	73-74	2
α-helix	76-79	4
α-helix	80-97	18
α-helix	98-100	3
α-helix	102-105	4
α-helix	106-112	7
β-strand	118	1	5
β-strand	126	1	5
α-helix	127-130	4
β-strand	131	1	6
β-strand	136	1	6
α-helix	138-152	15
β-strand	160-165	6	2
β-strand	169-170	2	4
α-helix	173-176	4
β-strand	183-186	4	2
α-helix	189-208	20
β-strand	215	1	7
α-helix	221-232	12
β-strand	237-239	3	7
α-helix	247-249	3
α-helix	252-264	13
α-helix	269-280	12
α-helix	282	1
β-strand	283-286	4	2
β-strand	290-294	5	2
α-helix	304-325	22
α-helix	329-334	6
β-strand	336-341	6	7
β-strand	344-349	6	7
α-helix	355-364	10
α-helix	378-380	3
β-strand	382	1	7
β-strand	389-390	2	8
β-strand	393-398	6	8
β-strand	401-405	5	8
α-helix	408-416	9
β-strand	417-423	7	3
α-helix	428	1
β-strand	429	1	3
α-helix	430-431	2
α-helix	437-448	12
α-helix	452-465	14
α-helix	478-486	9

Chain B: 31 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	8-9	2	9
β-strand	12-13	2	9
β-strand	14-17	4	10
α-helix	20-24	5
β-strand	27-31	5	11
α-helix	36-38	3
β-strand	43-44	2	12
α-helix	45-46	2
α-helix	59-67	9
α-helix	68-71	4
α-helix	73-74	2
α-helix	76-79	4
α-helix	80-95	16
α-helix	98-100	3
α-helix	102-105	4
α-helix	106-112	7
β-strand	118	1	13
β-strand	126	1	13
α-helix	127-130	4
β-strand	131	1	14
β-strand	136	1	14
α-helix	138-152	15
β-strand	160-165	6	10
β-strand	169-170	2	12
α-helix	173-176	4
β-strand	183-186	4	10
α-helix	187-188	2
α-helix	189-208	20
β-strand	215	1	15
α-helix	221-232	12
β-strand	237-239	3	15
α-helix	246-249	4
α-helix	252-264	13
α-helix	269-280	12
α-helix	282	1
β-strand	283-286	4	10
β-strand	290-294	5	10
α-helix	305-325	21
α-helix	329-334	6
β-strand	336-341	6	15
β-strand	344-349	6	15
α-helix	355-364	10
α-helix	378-380	3
β-strand	382	1	15
β-strand	389-390	2	16
β-strand	393-398	6	16
β-strand	401-405	5	16
α-helix	408-416	9
β-strand	417-423	7	11
α-helix	428	1
β-strand	429	1	11
α-helix	430	1
α-helix	437-448	12
α-helix	452-467	16
α-helix	478-487	10

Chain C: 26 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	8-9	2	17
β-strand	12-13	2	17
β-strand	14-17	4	18
α-helix	20-24	5
β-strand	27-31	5	19
α-helix	36-38	3
β-strand	43-44	2	20
α-helix	45-46	2
α-helix	59-67	9
α-helix	68-71	4
α-helix	73-74	2
α-helix	76-79	4
α-helix	80-97	18
α-helix	98-100	3
α-helix	102-105	4
α-helix	106-112	7
β-strand	118	1	21
β-strand	126	1	21
α-helix	127-130	4
β-strand	131	1	22
β-strand	136	1	22
α-helix	138-152	15
β-strand	160-165	6	18
β-strand	169-170	2	20
α-helix	173-176	4
β-strand	183-186	4	18
α-helix	189-208	20
β-strand	215	1	23
α-helix	221-233	13
β-strand	237-239	3	23
β-strand	244	1	24
α-helix	247-249	3
α-helix	252-264	13
α-helix	269-280	12
β-strand	283-286	4	18
β-strand	290-294	5	18
α-helix	304-325	22
α-helix	329-334	6
β-strand	336-341	6	23
β-strand	344-349	6	23
α-helix	355-364	10
β-strand	368	1	24
β-strand	382	1	23
β-strand	389-390	2	25
β-strand	393-398	6	25
β-strand	401-405	5	25
α-helix	408-416	9
β-strand	417-423	7	19
β-strand	429	1	19
α-helix	437-448	12
α-helix	452-465	14
α-helix	478-486	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA-dependent RNA polymerase	A, B, C	protein	515	murine norovirus	Q80J95 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3UQS_1 RNA-dependent RNA polymerase (chains A, B, C)
MLPRPSGTYAGLPIADYGDAPPLSTKTMFWRTSPEKLPPGAWEPAYLGSKDERVDGPSLQ
QVMRDQLKPYSEPRGLLPPQEILDAVCDAIENRLENTLEPQKPWTFKKACESLDKNTSSG
YPYHKQKSKDWTGSAFIGDLGDQATHANNMYEMGKSMRPIYTAALKDELVKPDKIYGKIK
KRLLWGSDLGTMIRAARAFGPFCDALKETCIFNPIRVGMSMNEDGPFIFARHANFRYHMD
ADYTRWDSTQQRAILKRAGDIMVRLSPEPDLARVVMDDLLAPSLLDVGDYKIVVEEGLPS
GCPCTTQLNSLAHWILTLCAMVEVTRVDPDIVMQESEFSFYGDDEVVSTNLELDMVKYTM
ALRRYGLLPTRADKEEGPLERRQTLQGISFLRRAIVGDQFGWYGRLDRASIDRQLLWTKG
PNHQNPFETLPGHAQRPSQLMALLGEAAMHGEKYYRTVASRVSKEAAQSGIEMVVPRHRS
VLRWVRFGTMDAETPQERSAVFVNEDELEHHHHHH

Primary citation

Structure-Based Inhibition of Norovirus RNA-Dependent RNA Polymerases. Mastrangelo, E., Pezzullo, M., Tarantino, D. et al. J Mol Biol (2012) 419:198-210. DOI 10.1016/j.jmb.2012.03.008 · PubMed

Other PDB entries of the same protein (UniProt Q80J95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ASH 1.58 Å, Crystal structure of the NS6 protease from murine norovirus 1
3SFG 2.21 Å, crystal structure of murine norovirus RNA dependent RNA polymerase in complex with…
4NRU 2.3 Å, Murine Norovirus RNA-dependent-RNA-polymerase in complex with Compound 6, a suramin…
4X2V 2.3 Å, Crystal structure of the Murine Norovirus NS6 protease (inactive C139A mutant) with a…
8A8X 2.37 Å, TRIM7 PRYSPRY in complex with a MNV1-NS3 peptide HDDFGLQ
4O4R 2.4 Å, Murine Norovirus RdRp in complex with PPNDS
4X2Y 2.42 Å, Crystal structure of a chimeric Murine Norovirus NS6 protease (inactive C139A mutant) in…
3UR0 2.45 Å, Crystal structures of murine norovirus RNA-dependent RNA polymerase in complex with…
4X2X 2.47 Å, Crystal structure of the Murine Norovirus NS6 protease (inactive C139A mutant) with a…
3QID 2.5 Å, Crystal structures and functional analysis of murine norovirus RNA-dependent RNA…
3SFU 2.5 Å, crystal structure of murine norovirus RNA dependent RNA polymerase in complex with…
3NAI 2.56 Å, Crystal structures and functional analysis of murine norovirus RNA-dependent RNA…

Browse structure collections

About this viewer

MolViewer shows 3UQS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.