Crystal structure of the Murine Norovirus NS6 protease (inactive C139A mutant) with a C-terminal extension to include residues P1 prime - P4 prime of NS7. Determined by X-ray diffraction at 2.47 Å resolution. Released 18 Feb 2015.
Explore 4X2X in 3D Show helices and sheets RCSB PDB PDBe
4X2X contains 7 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-8 | 4 | |
| β-strand | 9-12 | 4 | 1 |
| β-strand | 15-19 | 5 | 1 |
| β-strand | 24-28 | 5 | 1 |
| α-helix | 29-31 | 3 | |
| α-helix | 33-34 | 2 | |
| β-strand | 39 | 1 | 2 |
| β-strand | 42 | 1 | 2 |
| β-strand | 47-52 | 6 | 1 |
| β-strand | 55-60 | 6 | 1 |
| α-helix | 69-71 | 3 | |
| β-strand | 72-73 | 2 | 3 |
| β-strand | 82-88 | 7 | 3 |
| β-strand | 94-109 | 16 | 3 |
| β-strand | 112-121 | 10 | 3 |
| α-helix | 122-123 | 2 | |
| α-helix | 136-138 | 3 | |
| α-helix | 141 | 1 | |
| β-strand | 142-147 | 6 | 3 |
| β-strand | 150-160 | 11 | 3 |
| β-strand | 166-170 | 5 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NS6 protease | A | protein | 176 | Murine norovirus 1 | Q80J95 (AlphaFold model) |
>4X2X_1 NS6 protease (chains A) SIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSSGDFLKYYFTSA VRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMGSQAAIKIGSAVVHGQTGMLLT GSNAKAQDLGTIPGDAGCPYVYKKGNTWVVIGVHVAATRSGNTVIAATHGEPTLEA
Structure determination of Murine Norovirus NS6 proteases with C-terminal extensions designed to probe protease-substrate interactions. Fernandes, H., Leen, E.N., Cromwell, H. et al. PeerJ (2015) 3:e798-e798. DOI 10.7717/peerj.798 · PubMed
Other PDB entries of the same protein (UniProt Q80J95 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4X2X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.