4X2Y: NS6 Protease,NS6 Protease

Crystal structure of a chimeric Murine Norovirus NS6 protease (inactive C139A mutant) in which the P4-P4 prime residues of the cleavage junction in the extended C-terminus have been replaced by the corresponding residues from the NS2-3 junction. Determined by X-ray diffraction at 2.42 Å resolution. Released 18 Feb 2015.

Method: X-ray diffraction
Resolution: 2.42 Å
Organism: Murine norovirus 1
Chains: 2
Atoms: 2,669
Mol. weight: 37.65 kDa
Released: 18 Feb 2015

Explore 4X2Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4X2Y contains 13 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	9-12	4	1
β-strand	15-19	5	1
β-strand	24-28	5	1
α-helix	29-31	3
α-helix	33-34	2
β-strand	39	1	2
β-strand	42	1	2
β-strand	47-52	6	1
β-strand	55-60	6	1
α-helix	69-71	3
β-strand	72-73	2	3
β-strand	82-88	7	3
β-strand	94-108	15	3
β-strand	113-121	9	3
α-helix	122-123	2
β-strand	142-147	6	3
β-strand	150-160	11	3
β-strand	166-170	5	3

Chain B: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	9-12	4	4
β-strand	15-19	5	4
β-strand	24-28	5	4
α-helix	29-31	3
α-helix	33-34	2
β-strand	39	1	5
β-strand	42	1	5
α-helix	43	1
β-strand	47-52	6	4
β-strand	55-60	6	4
α-helix	69-71	3
β-strand	72-73	2	6
β-strand	82-88	7	6
β-strand	94-109	16	6
β-strand	112-121	10	6
α-helix	136-138	3
α-helix	141	1
β-strand	142-147	6	6
β-strand	150-160	11	6
β-strand	166-170	5	6
α-helix	178-179	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NS6 Protease,NS6 Protease	A, B	protein	179	Murine norovirus 1	Q80J95 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4X2Y_1 NS6 Protease,NS6 Protease (chains A, B)
SIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSSGDFLKYYFTSA
VRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMGSQAAIKIGSAVVHGQTGMLLT
GSNAKAQDLGTIPGDAGCPYVYKKGNTWVVIGVHVAATRSGNTVIAATHGEPTLEAWQA

Primary citation

Structure determination of Murine Norovirus NS6 proteases with C-terminal extensions designed to probe protease-substrate interactions. Fernandes, H., Leen, E.N., Cromwell, H. et al. PeerJ (2015) 3:e798-e798. DOI 10.7717/peerj.798 · PubMed

Other PDB entries of the same protein (UniProt Q80J95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ASH 1.58 Å, Crystal structure of the NS6 protease from murine norovirus 1
3UQS 2.0 Å, Crystal structures of murine norovirus RNA-dependent RNA polymerase
3SFG 2.21 Å, crystal structure of murine norovirus RNA dependent RNA polymerase in complex with…
4NRU 2.3 Å, Murine Norovirus RNA-dependent-RNA-polymerase in complex with Compound 6, a suramin…
4X2V 2.3 Å, Crystal structure of the Murine Norovirus NS6 protease (inactive C139A mutant) with a…
8A8X 2.37 Å, TRIM7 PRYSPRY in complex with a MNV1-NS3 peptide HDDFGLQ
4O4R 2.4 Å, Murine Norovirus RdRp in complex with PPNDS
3UR0 2.45 Å, Crystal structures of murine norovirus RNA-dependent RNA polymerase in complex with…
4X2X 2.47 Å, Crystal structure of the Murine Norovirus NS6 protease (inactive C139A mutant) with a…
3QID 2.5 Å, Crystal structures and functional analysis of murine norovirus RNA-dependent RNA…
3SFU 2.5 Å, crystal structure of murine norovirus RNA dependent RNA polymerase in complex with…
3NAI 2.56 Å, Crystal structures and functional analysis of murine norovirus RNA-dependent RNA…

Browse structure collections

About this viewer

MolViewer shows 4X2Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.