Structure of the rhesus monkey TRIM5alpha deltav1 PRYSPRY domain. Determined by X-ray diffraction at 1.55 Å resolution. Released 8 Aug 2012.
Explore 3UV9 in 3D Show helices and sheets RCSB PDB PDBe
3UV9 contains 6 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 292-296 | 5 | |
| α-helix | 297-299 | 3 | |
| α-helix | 305-307 | 3 | |
| β-strand | 314-315 | 2 | 1 |
| β-strand | 322-323 | 2 | 1 |
| β-strand | 352-353 | 2 | 2 |
| β-strand | 358 | 1 | 3 |
| β-strand | 362-368 | 7 | 4 |
| β-strand | 375-380 | 6 | 2 |
| α-helix | 391-394 | 4 | |
| α-helix | 399-401 | 3 | |
| β-strand | 403-409 | 7 | 2 |
| β-strand | 413-418 | 6 | 2 |
| β-strand | 429-432 | 4 | 2 |
| β-strand | 441-447 | 7 | 4 |
| β-strand | 452-457 | 6 | 4 |
| β-strand | 463-468 | 6 | 4 |
| β-strand | 477 | 1 | 3 |
| β-strand | 478-482 | 5 | 2 |
| β-strand | 491-492 | 2 | 4 |
| α-helix | 493-494 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tripartite motif-containing protein 5 | A | protein | 186 | Macaca mulatta | Q0PF16 (AlphaFold model) |
>3UV9_1 Tripartite motif-containing protein 5 (chains A) GTELTDARRYWVDVTLATNNISHAVIAEDKRQVSSRAGTGVLGSQSITSGKHYWEVDVSK KSAWILGVCAGFQSDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIV PLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMT LCSPSS
Structure of the rhesus monkey TRIM5alpha PRYSPRY domain, the HIV capsid recognition module. Biris, N., Yang, Y., Taylor, A.B. et al. Proc Natl Acad Sci U S A (2012) 109:13278-13283. DOI 10.1073/pnas.1203536109 · PubMed
Other PDB entries of the same protein (UniProt Q0PF16 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3UV9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.