3UV9: Rhesus monkey TRIM5alpha deltav1 PRYSPRY domain

Structure of the rhesus monkey TRIM5alpha deltav1 PRYSPRY domain. Determined by X-ray diffraction at 1.55 Å resolution. Released 8 Aug 2012.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Macaca mulatta
Chains: 1
Atoms: 1,617
Mol. weight: 20.74 kDa
Released: 8 Aug 2012

Explore 3UV9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UV9 contains 6 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	292-296	5
α-helix	297-299	3
α-helix	305-307	3
β-strand	314-315	2	1
β-strand	322-323	2	1
β-strand	352-353	2	2
β-strand	358	1	3
β-strand	362-368	7	4
β-strand	375-380	6	2
α-helix	391-394	4
α-helix	399-401	3
β-strand	403-409	7	2
β-strand	413-418	6	2
β-strand	429-432	4	2
β-strand	441-447	7	4
β-strand	452-457	6	4
β-strand	463-468	6	4
β-strand	477	1	3
β-strand	478-482	5	2
β-strand	491-492	2	4
α-helix	493-494	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tripartite motif-containing protein 5	A	protein	186	Macaca mulatta	Q0PF16 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3UV9_1 Tripartite motif-containing protein 5 (chains A)
GTELTDARRYWVDVTLATNNISHAVIAEDKRQVSSRAGTGVLGSQSITSGKHYWEVDVSK
KSAWILGVCAGFQSDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIV
PLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMT
LCSPSS

Primary citation

Structure of the rhesus monkey TRIM5alpha PRYSPRY domain, the HIV capsid recognition module. Biris, N., Yang, Y., Taylor, A.B. et al. Proc Natl Acad Sci U S A (2012) 109:13278-13283. DOI 10.1073/pnas.1203536109 · PubMed

Other PDB entries of the same protein (UniProt Q0PF16 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5K3Q 1.8 Å, Rhesus macaques Trim5alpha Bbox2 domain
5EIU 1.91 Å, Mini TRIM5 B-box 2 dimer C2 crystal form
4TKP 2.08 Å, Complex of Ubc13 with the RING domain of the TRIM5alpha retroviral restriction factor
5F7T 2.29 Å, TRIM5 B-box2 and coiled-coil chimera
5W9A 2.74 Å, The structure of the Trim5alpha Bbox- coiled coil in complex LC3B
5IEA 3.26 Å, TRIM5 B-box2 and coiled-coil chimera
4B3N 3.3 Å, Crystal structure of rhesus TRIM5alpha PRY/SPRY domain
2LM3 Structure of the rhesus monkey TRIM5alpha PRYSPRY domain

Browse structure collections

About this viewer

MolViewer shows 3UV9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.