Crystal structure of the PPARgamma-LBD complexed with a cercosporamide derivative modulator. Determined by X-ray diffraction at 1.65 Å resolution. Released 1 Feb 2012.
Explore 3V9T in 3D Show helices and sheets RCSB PDB PDBe
3V9T contains 14 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 207-225 | 19 | |
| α-helix | 230-238 | 9 | |
| α-helix | 244-246 | 3 | |
| β-strand | 247-249 | 3 | 1 |
| α-helix | 252-258 | 7 | |
| α-helix | 277-301 | 25 | |
| α-helix | 306-308 | 3 | |
| α-helix | 311-332 | 22 | |
| β-strand | 334-335 | 2 | 1 |
| β-strand | 338-341 | 4 | 1 |
| β-strand | 346-349 | 4 | 1 |
| α-helix | 350-355 | 6 | |
| α-helix | 361-375 | 15 | |
| α-helix | 381-392 | 12 | |
| α-helix | 403-424 | 22 | |
| α-helix | 431-459 | 29 | |
| α-helix | 467-473 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-14 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peroxisome proliferator-activated receptor gamma | A | protein | 283 | Homo sapiens | P37231 (AlphaFold model) |
| Peptide from Peroxisome proliferator-activated receptor gamma coactivator 1-alpha | C | protein | 19 | Homo sapiens | Q9UBK2 (AlphaFold model) |
>3V9T_1 Peroxisome proliferator-activated receptor gamma (chains A) MRGSHHHHHHGPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNS LMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQ VTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKF NALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAK LLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
>3V9T_2 Peptide from Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (chains C) QEAEEPSLLKKLLLAPANT
| ID | Name | Formula | Copies |
|---|---|---|---|
| 17L | (9aS)-8-acetyl-N-[(3-ethoxynaphthalen-1-yl)methyl]-1,7-dihydroxy-3-methoxy-9a-m… | C30 H27 N O8 | 1 |
Substituents at the naphthalene C3 position of (-)-Cercosporamide derivatives significantly affect the maximal efficacy as PPAR(gamma) partial agonists. Furukawa, A., Arita, T., Fukuzaki, T. et al. Bioorg Med Chem Lett (2012) 22:1348-1351. DOI 10.1016/j.bmcl.2011.12.066 · PubMed
Other PDB entries of the same protein (UniProt P37231 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3V9T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.