3VDK: Circumsporozoite protein

Crystal structure of circumsporozoite protein aTSR domain, R32 platinum-bound form. Determined by X-ray diffraction at 1.85 Å resolution. Released 9 May 2012.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Plasmodium falciparum
Chains: 1
Atoms: 620
Mol. weight: 9.1 kDa
Ligands: PT
Released: 9 May 2012

Explore 3VDK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VDK contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	313-322	10
α-helix	331-334	4
β-strand	340-346	7	1
α-helix	348-350	3
α-helix	355-357	3
α-helix	360-363	4
β-strand	364-370	7	1
α-helix	373-375	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Circumsporozoite (CS) protein	A	protein	77	Plasmodium falciparum	Q7K740 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3VDK_1 Circumsporozoite (CS) protein (chains A)
YVEFEPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIE
KKICKMEKCPHHHHHHA

Ligands and cofactors

ID	Name	Formula	Copies
PT	Platinum (II) ion	Pt	1

Primary citation

Unexpected fold in the circumsporozoite protein target of malaria vaccines. Doud, M.B., Koksal, A.C., Mi, L.Z. et al. Proc Natl Acad Sci U S A (2012) 109:7817-7822. DOI 10.1073/pnas.1205737109 · PubMed

Other PDB entries of the same protein (UniProt Q7K740 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SG5 1.4 Å, Structure of PfCSP peptide 21 with antibody CIS43_Var2
9C79 1.46 Å, Human monoclonal antibody MAD21-101 bound to the N-terminus of cleaved circumsporozoite…
9NKZ 1.48 Å, Crystal structure of Fab MAM01 in complex with NANP6 peptide from circumsporozoite protein
9NL0 1.54 Å, Crystal structure of Fab MAM01 in complex with NPNA3 peptide from circumsporozoite protein
7SG6 1.55 Å, Structure of PfCSP peptide 21 with antibody CIS43_Var10
6PBV 1.57 Å, Crystal structure of Fab668 complex
9NCY 1.63 Å, Fab1392 in complex with the C-terminal alpha-TSR domain of the P. falciparum…
3VDJ 1.7 Å, Crystal structure of circumsporozoite protein aTSR domain, R32 native form
9DST 1.74 Å, Crystal structure of Fab MS-1805 in complex with N-terminal junction peptide from…
9NI1 1.75 Å, Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum…
7RXP 1.76 Å, Fab1512 in complex with the C-terminal alpha-TSR domain of P. falciparum
6BQB 1.77 Å, MGG4 Fab in complex with peptide

Browse structure collections

About this viewer

MolViewer shows 3VDK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.